Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1692
Gene name
LocationContig_1382:4454..5160
Strand-
Gene length (bp)706
Transcript length (bp)522
Coding sequence length (bp)522
Protein length (aa) 174

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16015 Promethin Promethin 1.6E-32 32 136

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 85 107 22
3 114 136 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1692
MASSQDQRRRSSSFRDSVNDKAAGVYALAQRSLDYVVAPSSRRRAYDSASSLASSRPILFSFAVSQLLFSFLPLL
FFALFSAGTVAFALGLAILFSLFWIGLALLVLVPTLLVASSIAVLVWAWAVGSFLVARWLYLHAPVAVAGGLHVD
AAGRHLHVVKGENGVGGSVDGAH*
Coding >Hirsu2|1692
ATGGCGTCGTCGCAGGACCAGCGCCGTCGAAGCAGCAGCTTCCGCGACTCGGTCAACGACAAGGCTGCCGGCGTC
TACGCCTTGGCCCAGCGCTCTCTCGACTACGTCGTCGCCCCGTCGTCGCGCCGCCGCGCATACGACTCGGCCTCG
TCTCTCGCCTCGTCGCGGCCCATTCTCTTTTCCTTCGCCGTCTCGCAGCTCCTCTTCTCCTTCCTGCCGCTCCTC
TTCTTCGCCCTCTTCTCCGCCGGCACCGTCGCCTTCGCCCTCGGTCTCGCCATCCTCTTCTCCCTCTTCTGGATC
GGCCTCGCCCTGCTGGTCCTCGTCCCCACCCTGCTCGTCGCCTCGTCCATCGCCGTCCTCGTCTGGGCCTGGGCC
GTCGGCAGCTTCCTCGTCGCCCGCTGGCTCTACCTCCACGCCCCCGTCGCCGTCGCCGGCGGCCTGCACGTCGAC
GCCGCCGGTAGGCACCTGCACGTCGTCAAGGGCGAAAACGGCGTCGGCGGCAGCGTCGACGGCGCCCACTGA
Transcript >Hirsu2|1692
ATGGCGTCGTCGCAGGACCAGCGCCGTCGAAGCAGCAGCTTCCGCGACTCGGTCAACGACAAGGCTGCCGGCGTC
TACGCCTTGGCCCAGCGCTCTCTCGACTACGTCGTCGCCCCGTCGTCGCGCCGCCGCGCATACGACTCGGCCTCG
TCTCTCGCCTCGTCGCGGCCCATTCTCTTTTCCTTCGCCGTCTCGCAGCTCCTCTTCTCCTTCCTGCCGCTCCTC
TTCTTCGCCCTCTTCTCCGCCGGCACCGTCGCCTTCGCCCTCGGTCTCGCCATCCTCTTCTCCCTCTTCTGGATC
GGCCTCGCCCTGCTGGTCCTCGTCCCCACCCTGCTCGTCGCCTCGTCCATCGCCGTCCTCGTCTGGGCCTGGGCC
GTCGGCAGCTTCCTCGTCGCCCGCTGGCTCTACCTCCACGCCCCCGTCGCCGTCGCCGGCGGCCTGCACGTCGAC
GCCGCCGGTAGGCACCTGCACGTCGTCAAGGGCGAAAACGGCGTCGGCGGCAGCGTCGACGGCGCCCACTGA
Gene >Hirsu2|1692
ATGGCGTCGTCGCAGGACCAGCGCCGTCGAAGCAGCAGCTTCCGCGACTCGGTCAACGACAAGGCTGCCGGCGTC
TACGCCTTGGCCCAGCGCTCTCTCGACTACGTCGTCGCCCCGTCGTCGCGCCGCCGCGCATACGACTCGGCCTCG
TCTCTCGCCTCGTCGCGGCCCATTCTCTTTGTACGTCCCGATCCCCCGCCATGGACGGCCTGGGTCAAGCTTGTG
CATGCCACGTTGTGTACATACAGACTGTGCACGCCGCATGAGACAAGACGGTCTCGTCGCCGTCCTTTTGCATCT
TTCTTTTTTCCTCTCGGCCTTGTGAGACTCCGATCCCCCCGCTGACCGGCGCTGCCCGCTCCAGTCCTTCGCCGT
CTCGCAGCTCCTCTTCTCCTTCCTGCCGCTCCTCTTCTTCGCCCTCTTCTCCGCCGGCACCGTCGCCTTCGCCCT
CGGTCTCGCCATCCTCTTCTCCCTCTTCTGGATCGGCCTCGCCCTGCTGGTCCTCGTCCCCACCCTGCTCGTCGC
CTCGTCCATCGCCGTCCTCGTCTGGGCCTGGGCCGTCGGCAGCTTCCTCGTCGCCCGCTGGCTCTACCTCCACGC
CCCCGTCGCCGTCGCCGGCGGCCTGCACGTCGACGCCGCCGGTAGGCACCTGCACGTCGTCAAGGGCGAAAACGG
CGTCGGCGGCAGCGTCGACGGCGCCCACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail