Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1686
Gene name
LocationContig_1381:22..490
Strand+
Gene length (bp)468
Transcript length (bp)468
Coding sequence length (bp)468
Protein length (aa) 156

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02537 CRCB CrcB-like protein, Camphor Resistance (CrcB) 1.1E-24 31 139

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UTS8|YI7B_SCHPO UPF0695 membrane protein C977.11/PB8B6.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.11 PE=3 SV=1 10 151 5.0E-18
sp|Q08913|YO390_YEAST UPF0695 membrane protein YOR390W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR390W PE=3 SV=1 22 154 8.0E-17
sp|Q08991|YP279_YEAST UPF0695 membrane protein YPL279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL279C PE=3 SV=1 22 154 3.0E-16
sp|A5GAD3|CRCB_GEOUR Putative fluoride ion transporter CrcB OS=Geobacter uraniireducens (strain Rf4) GN=crcB PE=3 SV=1 34 132 5.0E-06

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 2 19 17
2 29 50 21
3 57 79 22
4 94 116 22
5 121 143 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1686
LCVLLGWGCWLGAVLLSVWPPRDFWRGRATLALVFAPPGCLLRFYLAALLNGRRPAFPLGTFAANVFGCAVLAMA
WDIAHVPVGGYVGCQVLQGIEDGFCGCLTTISTWVAELAALRRLHAYLYGAASVLVSFALMVVIMGGLRWTDGFS
HLDCH*
Coding >Hirsu2|1686
CTGTGCGTCCTGCTCGGCTGGGGCTGCTGGCTCGGCGCCGTGCTGCTGTCCGTCTGGCCGCCGCGCGACTTCTGG
CGCGGCCGCGCCACGCTCGCCCTCGTCTTCGCCCCGCCCGGCTGCCTGCTGCGCTTCTACCTGGCCGCCCTGCTC
AACGGCCGCCGGCCGGCCTTCCCGCTCGGCACCTTCGCCGCCAACGTCTTCGGCTGCGCCGTGCTGGCCATGGCC
TGGGACATCGCCCATGTGCCCGTCGGCGGCTACGTCGGCTGCCAGGTCCTGCAGGGCATCGAGGACGGCTTCTGC
GGCTGCCTGACCACCATCTCGACCTGGGTCGCCGAGCTGGCCGCCCTGCGCCGCCTGCACGCCTACCTCTACGGC
GCCGCCAGCGTCCTCGTCTCCTTTGCGCTCATGGTCGTCATCATGGGCGGCCTGCGCTGGACCGACGGCTTCAGC
CACCTCGACTGCCACTGA
Transcript >Hirsu2|1686
CTGTGCGTCCTGCTCGGCTGGGGCTGCTGGCTCGGCGCCGTGCTGCTGTCCGTCTGGCCGCCGCGCGACTTCTGG
CGCGGCCGCGCCACGCTCGCCCTCGTCTTCGCCCCGCCCGGCTGCCTGCTGCGCTTCTACCTGGCCGCCCTGCTC
AACGGCCGCCGGCCGGCCTTCCCGCTCGGCACCTTCGCCGCCAACGTCTTCGGCTGCGCCGTGCTGGCCATGGCC
TGGGACATCGCCCATGTGCCCGTCGGCGGCTACGTCGGCTGCCAGGTCCTGCAGGGCATCGAGGACGGCTTCTGC
GGCTGCCTGACCACCATCTCGACCTGGGTCGCCGAGCTGGCCGCCCTGCGCCGCCTGCACGCCTACCTCTACGGC
GCCGCCAGCGTCCTCGTCTCCTTTGCGCTCATGGTCGTCATCATGGGCGGCCTGCGCTGGACCGACGGCTTCAGC
CACCTCGACTGCCACTGA
Gene >Hirsu2|1686
CTGTGCGTCCTGCTCGGCTGGGGCTGCTGGCTCGGCGCCGTGCTGCTGTCCGTCTGGCCGCCGCGCGACTTCTGG
CGCGGCCGCGCCACGCTCGCCCTCGTCTTCGCCCCGCCCGGCTGCCTGCTGCGCTTCTACCTGGCCGCCCTGCTC
AACGGCCGCCGGCCGGCCTTCCCGCTCGGCACCTTCGCCGCCAACGTCTTCGGCTGCGCCGTGCTGGCCATGGCC
TGGGACATCGCCCATGTGCCCGTCGGCGGCTACGTCGGCTGCCAGGTCCTGCAGGGCATCGAGGACGGCTTCTGC
GGCTGCCTGACCACCATCTCGACCTGGGTCGCCGAGCTGGCCGCCCTGCGCCGCCTGCACGCCTACCTCTACGGC
GCCGCCAGCGTCCTCGTCTCCTTTGCGCTCATGGTCGTCATCATGGGCGGCCTGCGCTGGACCGACGGCTTCAGC
CACCTCGACTGCCACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail