Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1681
Gene name
LocationContig_138:33817..34415
Strand+
Gene length (bp)598
Transcript length (bp)435
Coding sequence length (bp)435
Protein length (aa) 145

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02784 Orn_Arg_deC_N Pyridoxal-dependent decarboxylase, pyridoxal binding domain 6.3E-26 76 144

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27121|DCOR_NEUCR Ornithine decarboxylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spe-1 PE=2 SV=1 43 144 4.0E-53
sp|P08432|DCOR_YEAST Ornithine decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPE1 PE=1 SV=1 31 144 2.0E-38
sp|Q9UQW9|DCOR_SCHPO Ornithine decarboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spe1 PE=2 SV=1 23 144 1.0E-37
sp|P27117|DCOR_BOVIN Ornithine decarboxylase OS=Bos taurus GN=ODC1 PE=2 SV=1 49 144 4.0E-31
sp|P11926|DCOR_HUMAN Ornithine decarboxylase OS=Homo sapiens GN=ODC1 PE=1 SV=2 49 144 5.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27121|DCOR_NEUCR Ornithine decarboxylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spe-1 PE=2 SV=1 43 144 4.0E-53
sp|P08432|DCOR_YEAST Ornithine decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPE1 PE=1 SV=1 31 144 2.0E-38
sp|Q9UQW9|DCOR_SCHPO Ornithine decarboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spe1 PE=2 SV=1 23 144 1.0E-37
sp|P27117|DCOR_BOVIN Ornithine decarboxylase OS=Bos taurus GN=ODC1 PE=2 SV=1 49 144 4.0E-31
sp|P11926|DCOR_HUMAN Ornithine decarboxylase OS=Homo sapiens GN=ODC1 PE=1 SV=2 49 144 5.0E-31
sp|P09057|DCOR_RAT Ornithine decarboxylase OS=Rattus norvegicus GN=Odc1 PE=1 SV=1 49 144 5.0E-31
sp|P27118|DCOR_CHICK Ornithine decarboxylase (Fragment) OS=Gallus gallus GN=ODC1 PE=2 SV=1 49 144 1.0E-30
sp|Q9I8S4|AZIN2_XENLA Antizyme inhibitor 2 OS=Xenopus laevis GN=azin2 PE=2 SV=1 58 144 2.0E-30
sp|P27119|DCOR_MUSPA Ornithine decarboxylase OS=Mus pahari GN=Odc1 PE=2 SV=1 49 144 4.0E-30
sp|P27120|DCOR1_XENLA Ornithine decarboxylase 1 OS=Xenopus laevis GN=odc1-a PE=2 SV=1 30 144 2.0E-29
sp|P00860|DCOR_MOUSE Ornithine decarboxylase OS=Mus musculus GN=Odc1 PE=1 SV=2 49 144 2.0E-29
sp|P07805|DCOR_TRYBB Ornithine decarboxylase OS=Trypanosoma brucei brucei PE=1 SV=2 30 144 2.0E-28
sp|P78599|DCOR_CANAL Ornithine decarboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPE1 PE=3 SV=1 46 144 3.0E-28
sp|Q54UF3|DCOR_DICDI Probable ornithine decarboxylase OS=Dictyostelium discoideum GN=odc PE=3 SV=1 67 144 4.0E-28
sp|P50134|DCOR_DATST Ornithine decarboxylase OS=Datura stramonium PE=2 SV=1 49 144 2.0E-25
sp|O22616|DCOR_SOLLC Ornithine decarboxylase OS=Solanum lycopersicum GN=ODC PE=2 SV=2 46 144 3.0E-25
sp|Q8S3N2|DCOR_CAPAN Ornithine decarboxylase OS=Capsicum annuum GN=ODC PE=2 SV=1 46 144 5.0E-25
sp|P40807|DCOR1_DROME Ornithine decarboxylase 1 OS=Drosophila melanogaster GN=Odc1 PE=2 SV=3 73 144 5.0E-24
sp|P14019|DCOR_CRIGR Ornithine decarboxylase OS=Cricetulus griseus GN=ODC1 PE=2 SV=3 49 144 9.0E-22
sp|P41931|DCOR_CAEEL Ornithine decarboxylase OS=Caenorhabditis elegans GN=odc-1 PE=3 SV=2 67 144 2.0E-21
sp|P40808|DCOR2_DROME Ornithine decarboxylase 2 OS=Drosophila melanogaster GN=Odc2 PE=3 SV=2 73 144 2.0E-21
sp|P27116|DCOR_LEIDO Ornithine decarboxylase OS=Leishmania donovani PE=3 SV=1 68 144 5.0E-21
sp|Q63764|AZIN1_RAT Antizyme inhibitor 1 OS=Rattus norvegicus GN=Azin1 PE=1 SV=1 68 144 9.0E-21
sp|O35484|AZIN1_MOUSE Antizyme inhibitor 1 OS=Mus musculus GN=Azin1 PE=1 SV=1 68 144 1.0E-20
sp|Q96A70|AZIN2_HUMAN Antizyme inhibitor 2 OS=Homo sapiens GN=AZIN2 PE=1 SV=1 71 144 2.0E-20
sp|Q5R7K3|AZIN1_PONAB Antizyme inhibitor 1 OS=Pongo abelii GN=AZIN1 PE=2 SV=1 68 144 3.0E-20
sp|O14977|AZIN1_HUMAN Antizyme inhibitor 1 OS=Homo sapiens GN=AZIN1 PE=1 SV=2 68 144 3.0E-20
sp|P49725|DCOR_PANRE Ornithine decarboxylase OS=Panagrellus redivivus GN=ODC PE=2 SV=1 66 144 5.0E-20
sp|Q8BVM4|AZIN2_MOUSE Antizyme inhibitor 2 OS=Mus musculus GN=Azin2 PE=1 SV=1 66 144 2.0E-18
sp|D4A693|AZIN2_RAT Antizyme inhibitor 2 OS=Rattus norvegicus GN=Azin2 PE=1 SV=2 66 144 1.0E-15
sp|O50657|DCLO_SELRU Lysine/ornithine decarboxylase OS=Selenomonas ruminantium GN=ldc PE=1 SV=1 71 144 1.0E-12
sp|Q9ZME5|DCDA_HELPJ Diaminopimelate decarboxylase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=lysA PE=3 SV=1 71 142 5.0E-08
sp|B4XMC6|DCDA_HELPX Diaminopimelate decarboxylase OS=Helicobacter pylori GN=lysA PE=1 SV=1 71 142 7.0E-07
sp|P19572|DCDA_PSEAE Diaminopimelate decarboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lysA PE=3 SV=2 72 142 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1681
MAAAVIDNYNQQHHHNQHHHHHHQQPLCDNDSSNVSLLPAAGARRLIGDALHQRVAAIDHEVCEPGDEDTFYVAD
LGHVYRQHLRWKKNLPRVKPFYAVKCNPDPQVLRLLAGLGTGFDCASKTEIEQVLAMGISPDRVIYAQP*
Coding >Hirsu2|1681
ATGGCAGCGGCTGTCATTGACAACTACAACCAGCAGCACCATCACAACCAGCACCATCATCACCACCACCAGCAG
CCGCTTTGTGACAATGACAGCAGCAATGTCAGCCTCCTCCCTGCCGCCGGTGCCAGGCGCCTGATCGGCGACGCC
CTCCACCAGCGCGTCGCCGCCATCGATCACGAGGTGTGCGAGCCCGGCGACGAGGACACCTTTTACGTCGCCGAC
CTCGGCCACGTCTACCGCCAGCACCTCCGCTGGAAGAAGAACCTGCCGCGCGTCAAGCCCTTTTACGCCGTCAAA
TGCAACCCGGACCCGCAGGTGCTCCGGCTCCTGGCCGGCCTCGGCACCGGCTTCGACTGCGCCTCCAAGACAGAG
ATTGAACAGGTGCTGGCCATGGGCATCAGCCCCGACCGCGTCATCTACGCCCAGCCATGA
Transcript >Hirsu2|1681
ATGGCAGCGGCTGTCATTGACAACTACAACCAGCAGCACCATCACAACCAGCACCATCATCACCACCACCAGCAG
CCGCTTTGTGACAATGACAGCAGCAATGTCAGCCTCCTCCCTGCCGCCGGTGCCAGGCGCCTGATCGGCGACGCC
CTCCACCAGCGCGTCGCCGCCATCGATCACGAGGTGTGCGAGCCCGGCGACGAGGACACCTTTTACGTCGCCGAC
CTCGGCCACGTCTACCGCCAGCACCTCCGCTGGAAGAAGAACCTGCCGCGCGTCAAGCCCTTTTACGCCGTCAAA
TGCAACCCGGACCCGCAGGTGCTCCGGCTCCTGGCCGGCCTCGGCACCGGCTTCGACTGCGCCTCCAAGACAGAG
ATTGAACAGGTGCTGGCCATGGGCATCAGCCCCGACCGCGTCATCTACGCCCAGCCATGA
Gene >Hirsu2|1681
ATGGCAGCGGCTGTCATTGACAACTACAACCAGCAGCACCATCACAACCAGCACCATCATCACCACCACCAGCAG
CCGCTTTGTGACAATGACAGCAGCAATGTCAGCCTCCTCCCTGCCGCCGGTGCCAGGCGCCTGATCGGCGACGCC
CTCCACCAGCGCGTCGCCGCCATCGATCACGAGGTGTGCGAGCCCGGCGACGAGGACACCTTTTACGTCGCCGAC
CTCGGCCACGTCTACCGCCAGCACCTCCGCTGGAAGAAGAACCTGCCGCGCGTCAAGCCCTTTTACGGTCAGTCC
AGACGTCCTCGACCTCGTGTCTCGCCGCCTCTTCTTCCTCTTCTTCCTCCTCCTCTTCGACTCCGACTCCGACTC
CGACTCTGACTTCCCTCCCCCGACGCAGCCGTCAAATGCAACCCGGACCCGCAGGTGCTCCGGCTCCTGGCCGGC
CTCGGCACCGGCTTCGACTGCGCCTCCAAGACAGAGATTGAACAGGTGCTGGCCATGGGCATCAGCCCCGACCGC
GTCATCTACGCCCAGCCGTGCAAGACCAACTCATACGTCCGCTTCGTCCGCTCCGTCGGCGTGCGCCAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail