Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1680
Gene name
LocationContig_138:28242..31284
Strand+
Gene length (bp)3042
Transcript length (bp)3042
Coding sequence length (bp)3042
Protein length (aa) 1014

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08367 M16C_assoc Peptidase M16C associated 3.2E-82 480 738
PF05193 Peptidase_M16_C Peptidase M16 inactive domain 4.5E-17 225 409
PF05193 Peptidase_M16_C Peptidase M16 inactive domain 4.7E-06 835 919
PF00675 Peptidase_M16 Insulinase (Peptidase family M16) 3.1E-07 73 159

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S7C0|CYM1_NEUCR Mitochondrial presequence protease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cym-1 PE=3 SV=1 1 1007 0.0E+00
sp|Q6BTC0|CYM1_DEBHA Mitochondrial presequence protease OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CYM1 PE=3 SV=2 16 1003 0.0E+00
sp|Q5RDG3|PREP_PONAB Presequence protease, mitochondrial OS=Pongo abelii GN=PITRM1 PE=2 SV=1 21 1001 0.0E+00
sp|Q8K411|PREP_MOUSE Presequence protease, mitochondrial OS=Mus musculus GN=Pitrm1 PE=1 SV=1 21 1001 0.0E+00
sp|Q5JRX3|PREP_HUMAN Presequence protease, mitochondrial OS=Homo sapiens GN=PITRM1 PE=1 SV=3 21 1001 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S7C0|CYM1_NEUCR Mitochondrial presequence protease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cym-1 PE=3 SV=1 1 1007 0.0E+00
sp|Q6BTC0|CYM1_DEBHA Mitochondrial presequence protease OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CYM1 PE=3 SV=2 16 1003 0.0E+00
sp|Q5RDG3|PREP_PONAB Presequence protease, mitochondrial OS=Pongo abelii GN=PITRM1 PE=2 SV=1 21 1001 0.0E+00
sp|Q8K411|PREP_MOUSE Presequence protease, mitochondrial OS=Mus musculus GN=Pitrm1 PE=1 SV=1 21 1001 0.0E+00
sp|Q5JRX3|PREP_HUMAN Presequence protease, mitochondrial OS=Homo sapiens GN=PITRM1 PE=1 SV=3 21 1001 0.0E+00
sp|Q5A301|CYM1_CANAL Mitochondrial presequence protease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CYM1 PE=3 SV=1 16 1005 0.0E+00
sp|Q7ZVZ6|PREP_DANRE Presequence protease, mitochondrial OS=Danio rerio GN=pitrm1 PE=2 SV=1 22 1001 0.0E+00
sp|Q6PF24|PREP_XENLA Presequence protease, mitochondrial OS=Xenopus laevis GN=pitrm1 PE=2 SV=1 23 1001 0.0E+00
sp|O42908|CYM1_SCHPO Mitochondrial presequence protease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cym1 PE=3 SV=1 22 891 0.0E+00
sp|Q6CWW6|CYM1_KLULA Mitochondrial presequence protease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CYM1 PE=3 SV=1 2 972 0.0E+00
sp|Q759T9|CYM1_ASHGO Mitochondrial presequence protease OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CYM1 PE=3 SV=2 1 998 0.0E+00
sp|P32898|CYM1_YEAST Mitochondrial presequence protease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYM1 PE=1 SV=2 6 975 0.0E+00
sp|Q6FUI7|CYM1_CANGA Mitochondrial presequence protease OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CYM1 PE=3 SV=1 3 972 0.0E+00
sp|Q6C0U8|CYM1_YARLI Mitochondrial presequence protease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CYM1 PE=3 SV=1 22 973 0.0E+00
sp|Q5B6H7|CYM1_EMENI Mitochondrial presequence protease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cym1 PE=3 SV=1 1 1009 0.0E+00
sp|Q4WP38|CYM1_ASPFU Mitochondrial presequence protease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cym1 PE=3 SV=1 4 1009 0.0E+00
sp|Q2UGN1|CYM1_ASPOR Mitochondrial presequence protease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cym1 PE=3 SV=1 6 1008 0.0E+00
sp|Q4IA56|CYM1_GIBZE Mitochondrial presequence protease OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYM1 PE=3 SV=1 1 1008 0.0E+00
sp|Q28BR5|PREP_XENTR Presequence protease, mitochondrial OS=Xenopus tropicalis GN=pitrm1 PE=2 SV=1 23 1001 0.0E+00
sp|Q9V9E3|PREP_DROME Presequence protease, mitochondrial OS=Drosophila melanogaster GN=CG3107 PE=2 SV=2 23 976 6.0E-176
sp|Q9LJL3|PREP1_ARATH Presequence protease 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=PREP1 PE=1 SV=2 19 989 8.0E-135
sp|Q8VY06|PREP2_ARATH Presequence protease 2, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=PREP2 PE=1 SV=1 17 969 2.0E-133
sp|Q46205|HYPA_CLOPE Protein HypA OS=Clostridium perfringens (strain 13 / Type A) GN=hypA PE=4 SV=2 21 968 5.0E-113
sp|O51246|Y228_BORBU Uncharacterized protein BB_0228 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=BB_0228 PE=4 SV=1 29 973 5.0E-78
sp|P48053|YPD1_CAEEL Uncharacterized protein C05D11.1 OS=Caenorhabditis elegans GN=C05D11.1 PE=4 SV=2 69 549 2.0E-21
sp|Q12496|YO098_YEAST Uncharacterized protein YOL098C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL098C PE=1 SV=1 78 507 1.0E-18
sp|Q10068|YAN2_SCHPO Uncharacterized protein C3H1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.02c PE=4 SV=1 49 345 3.0E-14
sp|P55679|Y4WA_RHISN Uncharacterized zinc protease y4wA OS=Rhizobium sp. (strain NGR234) GN=NGR_a01040 PE=3 SV=1 68 344 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1680
MLRNAANAARKAVTELSHYPKAGETLHGFTLVRSKHVPELELVALHLQHDKTGADYLHVAREDSNNVFSIGFKTN
PPDDTGVPHILEHTTLCGSQKFPIRDPFFKMLPRTLSNFMNAFTASDHTFYPFATTNTQDFKNLMSVYLDSTLHP
LLKQSDFTQEGWRIGPENPGGETSESAKLVFKGVVYNEMKGQMSDAGYLYYIRFHDHIFPDINNSGGDPQKITDL
TYEQLNKFHAEHYHPSNAKIFTYGDMPLADHLRELDARLETFDRTRADKRIHEPIQLDVPREVTVYGPLDPLVEA
DRQYKTSVSWVTGDTTDVLESFSISLLGTLLMDGYGSPLYRGLIESGMGADWSPIAGYDSSAKRGIFSIGLTGVQ
EADVPKLKSRVQEILRQARDKGFDRTKIDGTLHQLELSLKHKTANFGFSMLNRLKPRWFNGTDPFDSLAWNDTIQ
TFQAKLAQGGYLEGLVDKYLLNDKTLTFTMAPSPTYGEELAQEEQRRLSAKIDEAAKKAGDEEAARKLFEEQEQA
LLAEQSKTNTEDLGCLPTVHVKDIPRSREPVVTRDEAVQGVPTQWREAPTNGLTYFRAINTLKGLPDDLRELIPL
FTDSIMRLGTKDMTMEQLEDVMKLKTGGVSVEYHSTPSPTDFHQSSEGIILTGMALDRNVPVMYEMLRKLVLETD
FDSAEAPLRIRQLLQASADGVVNDIASSGHRFAMGYAESRLTRSAWERQQVAGLSQVELVTGLAGRAESDKLGDI
IGKLKRIQQFALGSDKMRAAITCGSESAADNAAALRTFLAGLPRGEAGAEAGAEAAGRWRVPTDRKTFFPLPYQV
YYSGLSVSTVPYTAAESAALQMLSQLLTHKHLHHEIREKGGAYGGGASYKPLDGLFSFYSYRDPNPQKTLEVMGK
AGRWAADKQWTARDMEEAKISVFQSVDAPRAVNQEGMARFLSGVTEEMRQRKREQLLDVTAQEVREAADKYLAAR
TEAGEERVALLGERPAWVKEGSWKLRQMKVAGGGGADE*
Coding >Hirsu2|1680
ATGCTTCGAAACGCTGCCAACGCAGCACGAAAGGCTGTCACAGAGCTTTCGCACTACCCCAAGGCCGGCGAAACG
CTCCACGGCTTCACCCTCGTTCGCTCCAAGCACGTCCCCGAGCTCGAGCTGGTTGCGCTGCACCTGCAGCATGAC
AAGACGGGCGCCGACTACTTGCACGTCGCCCGAGAAGACAGCAACAATGTCTTTTCCATCGGCTTCAAAACGAAC
CCGCCTGACGACACGGGTGTGCCGCACATACTAGAACATACGACGCTCTGCGGAAGCCAAAAGTTCCCCATCCGA
GATCCCTTTTTCAAGATGCTGCCCCGGACGCTGTCCAACTTCATGAATGCCTTCACCGCCAGCGACCACACCTTC
TACCCGTTCGCGACGACAAACACGCAAGACTTCAAGAACCTCATGTCTGTGTACCTCGACTCGACGCTGCACCCG
CTGCTCAAGCAGTCTGACTTTACGCAGGAAGGGTGGCGGATCGGCCCCGAGAATCCGGGCGGGGAGACGAGCGAG
AGCGCCAAGCTGGTCTTCAAGGGTGTCGTGTATAACGAGATGAAGGGGCAGATGTCCGATGCCGGCTACCTCTAC
TACATCCGCTTCCACGACCACATTTTCCCGGACATCAACAACTCGGGCGGCGACCCCCAAAAGATCACCGACCTC
ACGTACGAGCAGCTCAACAAGTTTCACGCCGAGCACTACCATCCGAGCAATGCCAAGATATTCACCTACGGGGAC
ATGCCGCTGGCCGATCATCTGCGAGAGCTCGACGCCCGGCTCGAGACCTTTGACCGAACACGCGCCGACAAGCGA
ATCCACGAACCCATCCAGCTTGACGTCCCGAGAGAAGTCACCGTGTACGGGCCGCTTGACCCGCTAGTAGAGGCC
GATCGCCAGTATAAGACGTCGGTATCATGGGTCACGGGTGACACGACCGACGTCCTCGAGTCGTTTTCCATTTCC
CTGCTGGGCACTCTGCTGATGGACGGCTACGGCTCGCCCCTGTACCGAGGCCTCATCGAGAGCGGCATGGGCGCC
GACTGGAGCCCCATCGCAGGATACGACAGCTCGGCCAAGCGCGGCATCTTCTCGATTGGCTTGACTGGTGTGCAG
GAGGCCGACGTGCCCAAGCTCAAGTCCCGCGTCCAAGAGATACTGCGCCAAGCGCGGGACAAGGGATTTGACAGG
ACCAAGATCGACGGGACGCTGCACCAGCTCGAGCTCTCGCTCAAGCACAAGACGGCCAATTTCGGCTTCTCGATG
CTCAACAGGCTGAAGCCGAGGTGGTTCAACGGGACCGATCCCTTCGACTCGCTGGCCTGGAACGACACGATCCAG
ACCTTCCAGGCCAAACTGGCGCAAGGCGGCTACCTGGAGGGCCTGGTTGACAAGTATCTGCTCAACGACAAGACG
CTGACGTTCACCATGGCGCCCTCGCCGACTTACGGAGAGGAACTGGCGCAGGAAGAGCAGCGTCGGCTGTCGGCC
AAGATCGACGAGGCGGCGAAGAAGGCCGGCGACGAAGAGGCGGCGCGGAAGCTGTTTGAGGAGCAGGAGCAGGCG
CTTCTCGCAGAGCAGAGCAAGACCAACACGGAGGACCTCGGCTGCTTACCGACGGTCCACGTCAAAGACATACCC
CGCAGCAGAGAGCCGGTCGTGACGCGGGACGAGGCGGTGCAAGGGGTGCCGACGCAGTGGCGGGAGGCGCCGACC
AACGGGCTGACGTACTTCCGGGCCATCAATACGCTCAAGGGGCTCCCGGACGACCTGCGAGAGCTGATTCCGCTC
TTCACGGATAGCATCATGAGGCTCGGGACCAAGGACATGACGATGGAGCAGCTGGAAGACGTCATGAAGCTCAAG
ACGGGCGGCGTCTCGGTCGAGTACCACTCGACGCCGTCGCCGACGGACTTCCACCAGTCCAGCGAGGGCATCATC
CTGACGGGCATGGCGCTGGACAGGAACGTGCCGGTCATGTACGAGATGCTGCGCAAGCTGGTGTTGGAAACCGAC
TTTGACAGTGCCGAGGCCCCCCTGAGGATACGGCAGCTGCTGCAGGCGTCGGCGGACGGCGTGGTCAACGACATC
GCGTCGTCGGGCCACCGGTTCGCCATGGGCTACGCCGAGTCGAGGCTGACGCGCAGCGCGTGGGAGAGGCAGCAG
GTGGCCGGGCTGTCGCAGGTCGAGCTCGTGACGGGGCTGGCCGGACGGGCGGAGTCGGACAAGCTGGGGGACATC
ATCGGCAAGCTGAAGCGGATCCAACAGTTTGCGCTGGGCAGCGACAAGATGCGGGCGGCCATCACTTGCGGCTCG
GAAAGCGCAGCGGACAACGCGGCCGCGCTGCGGACGTTCTTGGCGGGCCTGCCGAGGGGGGAGGCCGGGGCGGAG
GCCGGGGCGGAGGCGGCGGGGCGGTGGCGGGTGCCGACGGACCGCAAGACGTTCTTTCCGCTGCCGTACCAGGTC
TACTACAGCGGACTGTCGGTGTCGACGGTGCCGTACACGGCGGCGGAGAGCGCGGCGCTGCAGATGCTGTCGCAG
CTGCTGACGCACAAGCACCTGCACCACGAGATACGCGAGAAGGGGGGCGCGTACGGCGGCGGGGCGTCGTACAAG
CCGCTGGACGGGCTGTTCAGCTTCTACTCGTACCGAGACCCCAACCCGCAGAAGACGCTCGAGGTCATGGGCAAG
GCCGGGCGGTGGGCGGCGGACAAGCAGTGGACGGCGCGGGACATGGAGGAGGCCAAGATCTCGGTGTTCCAGAGC
GTGGACGCGCCGCGGGCGGTGAACCAGGAGGGCATGGCCCGGTTCCTGTCGGGCGTGACGGAGGAGATGAGGCAG
CGGAAGCGGGAGCAGCTGCTGGACGTGACGGCACAAGAGGTGCGGGAGGCGGCGGACAAGTACCTGGCGGCGAGG
ACGGAGGCCGGGGAGGAGCGCGTCGCGTTGCTTGGCGAGAGGCCGGCGTGGGTGAAGGAGGGCTCATGGAAGCTG
CGGCAGATGAAGGTGGCCGGAGGCGGAGGGGCGGACGAGTGA
Transcript >Hirsu2|1680
ATGCTTCGAAACGCTGCCAACGCAGCACGAAAGGCTGTCACAGAGCTTTCGCACTACCCCAAGGCCGGCGAAACG
CTCCACGGCTTCACCCTCGTTCGCTCCAAGCACGTCCCCGAGCTCGAGCTGGTTGCGCTGCACCTGCAGCATGAC
AAGACGGGCGCCGACTACTTGCACGTCGCCCGAGAAGACAGCAACAATGTCTTTTCCATCGGCTTCAAAACGAAC
CCGCCTGACGACACGGGTGTGCCGCACATACTAGAACATACGACGCTCTGCGGAAGCCAAAAGTTCCCCATCCGA
GATCCCTTTTTCAAGATGCTGCCCCGGACGCTGTCCAACTTCATGAATGCCTTCACCGCCAGCGACCACACCTTC
TACCCGTTCGCGACGACAAACACGCAAGACTTCAAGAACCTCATGTCTGTGTACCTCGACTCGACGCTGCACCCG
CTGCTCAAGCAGTCTGACTTTACGCAGGAAGGGTGGCGGATCGGCCCCGAGAATCCGGGCGGGGAGACGAGCGAG
AGCGCCAAGCTGGTCTTCAAGGGTGTCGTGTATAACGAGATGAAGGGGCAGATGTCCGATGCCGGCTACCTCTAC
TACATCCGCTTCCACGACCACATTTTCCCGGACATCAACAACTCGGGCGGCGACCCCCAAAAGATCACCGACCTC
ACGTACGAGCAGCTCAACAAGTTTCACGCCGAGCACTACCATCCGAGCAATGCCAAGATATTCACCTACGGGGAC
ATGCCGCTGGCCGATCATCTGCGAGAGCTCGACGCCCGGCTCGAGACCTTTGACCGAACACGCGCCGACAAGCGA
ATCCACGAACCCATCCAGCTTGACGTCCCGAGAGAAGTCACCGTGTACGGGCCGCTTGACCCGCTAGTAGAGGCC
GATCGCCAGTATAAGACGTCGGTATCATGGGTCACGGGTGACACGACCGACGTCCTCGAGTCGTTTTCCATTTCC
CTGCTGGGCACTCTGCTGATGGACGGCTACGGCTCGCCCCTGTACCGAGGCCTCATCGAGAGCGGCATGGGCGCC
GACTGGAGCCCCATCGCAGGATACGACAGCTCGGCCAAGCGCGGCATCTTCTCGATTGGCTTGACTGGTGTGCAG
GAGGCCGACGTGCCCAAGCTCAAGTCCCGCGTCCAAGAGATACTGCGCCAAGCGCGGGACAAGGGATTTGACAGG
ACCAAGATCGACGGGACGCTGCACCAGCTCGAGCTCTCGCTCAAGCACAAGACGGCCAATTTCGGCTTCTCGATG
CTCAACAGGCTGAAGCCGAGGTGGTTCAACGGGACCGATCCCTTCGACTCGCTGGCCTGGAACGACACGATCCAG
ACCTTCCAGGCCAAACTGGCGCAAGGCGGCTACCTGGAGGGCCTGGTTGACAAGTATCTGCTCAACGACAAGACG
CTGACGTTCACCATGGCGCCCTCGCCGACTTACGGAGAGGAACTGGCGCAGGAAGAGCAGCGTCGGCTGTCGGCC
AAGATCGACGAGGCGGCGAAGAAGGCCGGCGACGAAGAGGCGGCGCGGAAGCTGTTTGAGGAGCAGGAGCAGGCG
CTTCTCGCAGAGCAGAGCAAGACCAACACGGAGGACCTCGGCTGCTTACCGACGGTCCACGTCAAAGACATACCC
CGCAGCAGAGAGCCGGTCGTGACGCGGGACGAGGCGGTGCAAGGGGTGCCGACGCAGTGGCGGGAGGCGCCGACC
AACGGGCTGACGTACTTCCGGGCCATCAATACGCTCAAGGGGCTCCCGGACGACCTGCGAGAGCTGATTCCGCTC
TTCACGGATAGCATCATGAGGCTCGGGACCAAGGACATGACGATGGAGCAGCTGGAAGACGTCATGAAGCTCAAG
ACGGGCGGCGTCTCGGTCGAGTACCACTCGACGCCGTCGCCGACGGACTTCCACCAGTCCAGCGAGGGCATCATC
CTGACGGGCATGGCGCTGGACAGGAACGTGCCGGTCATGTACGAGATGCTGCGCAAGCTGGTGTTGGAAACCGAC
TTTGACAGTGCCGAGGCCCCCCTGAGGATACGGCAGCTGCTGCAGGCGTCGGCGGACGGCGTGGTCAACGACATC
GCGTCGTCGGGCCACCGGTTCGCCATGGGCTACGCCGAGTCGAGGCTGACGCGCAGCGCGTGGGAGAGGCAGCAG
GTGGCCGGGCTGTCGCAGGTCGAGCTCGTGACGGGGCTGGCCGGACGGGCGGAGTCGGACAAGCTGGGGGACATC
ATCGGCAAGCTGAAGCGGATCCAACAGTTTGCGCTGGGCAGCGACAAGATGCGGGCGGCCATCACTTGCGGCTCG
GAAAGCGCAGCGGACAACGCGGCCGCGCTGCGGACGTTCTTGGCGGGCCTGCCGAGGGGGGAGGCCGGGGCGGAG
GCCGGGGCGGAGGCGGCGGGGCGGTGGCGGGTGCCGACGGACCGCAAGACGTTCTTTCCGCTGCCGTACCAGGTC
TACTACAGCGGACTGTCGGTGTCGACGGTGCCGTACACGGCGGCGGAGAGCGCGGCGCTGCAGATGCTGTCGCAG
CTGCTGACGCACAAGCACCTGCACCACGAGATACGCGAGAAGGGGGGCGCGTACGGCGGCGGGGCGTCGTACAAG
CCGCTGGACGGGCTGTTCAGCTTCTACTCGTACCGAGACCCCAACCCGCAGAAGACGCTCGAGGTCATGGGCAAG
GCCGGGCGGTGGGCGGCGGACAAGCAGTGGACGGCGCGGGACATGGAGGAGGCCAAGATCTCGGTGTTCCAGAGC
GTGGACGCGCCGCGGGCGGTGAACCAGGAGGGCATGGCCCGGTTCCTGTCGGGCGTGACGGAGGAGATGAGGCAG
CGGAAGCGGGAGCAGCTGCTGGACGTGACGGCACAAGAGGTGCGGGAGGCGGCGGACAAGTACCTGGCGGCGAGG
ACGGAGGCCGGGGAGGAGCGCGTCGCGTTGCTTGGCGAGAGGCCGGCGTGGGTGAAGGAGGGCTCATGGAAGCTG
CGGCAGATGAAGGTGGCCGGAGGCGGAGGGGCGGACGAGTGA
Gene >Hirsu2|1680
ATGCTTCGAAACGCTGCCAACGCAGCACGAAAGGCTGTCACAGAGCTTTCGCACTACCCCAAGGCCGGCGAAACG
CTCCACGGCTTCACCCTCGTTCGCTCCAAGCACGTCCCCGAGCTCGAGCTGGTTGCGCTGCACCTGCAGCATGAC
AAGACGGGCGCCGACTACTTGCACGTCGCCCGAGAAGACAGCAACAATGTCTTTTCCATCGGCTTCAAAACGAAC
CCGCCTGACGACACGGGTGTGCCGCACATACTAGAACATACGACGCTCTGCGGAAGCCAAAAGTTCCCCATCCGA
GATCCCTTTTTCAAGATGCTGCCCCGGACGCTGTCCAACTTCATGAATGCCTTCACCGCCAGCGACCACACCTTC
TACCCGTTCGCGACGACAAACACGCAAGACTTCAAGAACCTCATGTCTGTGTACCTCGACTCGACGCTGCACCCG
CTGCTCAAGCAGTCTGACTTTACGCAGGAAGGGTGGCGGATCGGCCCCGAGAATCCGGGCGGGGAGACGAGCGAG
AGCGCCAAGCTGGTCTTCAAGGGTGTCGTGTATAACGAGATGAAGGGGCAGATGTCCGATGCCGGCTACCTCTAC
TACATCCGCTTCCACGACCACATTTTCCCGGACATCAACAACTCGGGCGGCGACCCCCAAAAGATCACCGACCTC
ACGTACGAGCAGCTCAACAAGTTTCACGCCGAGCACTACCATCCGAGCAATGCCAAGATATTCACCTACGGGGAC
ATGCCGCTGGCCGATCATCTGCGAGAGCTCGACGCCCGGCTCGAGACCTTTGACCGAACACGCGCCGACAAGCGA
ATCCACGAACCCATCCAGCTTGACGTCCCGAGAGAAGTCACCGTGTACGGGCCGCTTGACCCGCTAGTAGAGGCC
GATCGCCAGTATAAGACGTCGGTATCATGGGTCACGGGTGACACGACCGACGTCCTCGAGTCGTTTTCCATTTCC
CTGCTGGGCACTCTGCTGATGGACGGCTACGGCTCGCCCCTGTACCGAGGCCTCATCGAGAGCGGCATGGGCGCC
GACTGGAGCCCCATCGCAGGATACGACAGCTCGGCCAAGCGCGGCATCTTCTCGATTGGCTTGACTGGTGTGCAG
GAGGCCGACGTGCCCAAGCTCAAGTCCCGCGTCCAAGAGATACTGCGCCAAGCGCGGGACAAGGGATTTGACAGG
ACCAAGATCGACGGGACGCTGCACCAGCTCGAGCTCTCGCTCAAGCACAAGACGGCCAATTTCGGCTTCTCGATG
CTCAACAGGCTGAAGCCGAGGTGGTTCAACGGGACCGATCCCTTCGACTCGCTGGCCTGGAACGACACGATCCAG
ACCTTCCAGGCCAAACTGGCGCAAGGCGGCTACCTGGAGGGCCTGGTTGACAAGTATCTGCTCAACGACAAGACG
CTGACGTTCACCATGGCGCCCTCGCCGACTTACGGAGAGGAACTGGCGCAGGAAGAGCAGCGTCGGCTGTCGGCC
AAGATCGACGAGGCGGCGAAGAAGGCCGGCGACGAAGAGGCGGCGCGGAAGCTGTTTGAGGAGCAGGAGCAGGCG
CTTCTCGCAGAGCAGAGCAAGACCAACACGGAGGACCTCGGCTGCTTACCGACGGTCCACGTCAAAGACATACCC
CGCAGCAGAGAGCCGGTCGTGACGCGGGACGAGGCGGTGCAAGGGGTGCCGACGCAGTGGCGGGAGGCGCCGACC
AACGGGCTGACGTACTTCCGGGCCATCAATACGCTCAAGGGGCTCCCGGACGACCTGCGAGAGCTGATTCCGCTC
TTCACGGATAGCATCATGAGGCTCGGGACCAAGGACATGACGATGGAGCAGCTGGAAGACGTCATGAAGCTCAAG
ACGGGCGGCGTCTCGGTCGAGTACCACTCGACGCCGTCGCCGACGGACTTCCACCAGTCCAGCGAGGGCATCATC
CTGACGGGCATGGCGCTGGACAGGAACGTGCCGGTCATGTACGAGATGCTGCGCAAGCTGGTGTTGGAAACCGAC
TTTGACAGTGCCGAGGCCCCCCTGAGGATACGGCAGCTGCTGCAGGCGTCGGCGGACGGCGTGGTCAACGACATC
GCGTCGTCGGGCCACCGGTTCGCCATGGGCTACGCCGAGTCGAGGCTGACGCGCAGCGCGTGGGAGAGGCAGCAG
GTGGCCGGGCTGTCGCAGGTCGAGCTCGTGACGGGGCTGGCCGGACGGGCGGAGTCGGACAAGCTGGGGGACATC
ATCGGCAAGCTGAAGCGGATCCAACAGTTTGCGCTGGGCAGCGACAAGATGCGGGCGGCCATCACTTGCGGCTCG
GAAAGCGCAGCGGACAACGCGGCCGCGCTGCGGACGTTCTTGGCGGGCCTGCCGAGGGGGGAGGCCGGGGCGGAG
GCCGGGGCGGAGGCGGCGGGGCGGTGGCGGGTGCCGACGGACCGCAAGACGTTCTTTCCGCTGCCGTACCAGGTC
TACTACAGCGGACTGTCGGTGTCGACGGTGCCGTACACGGCGGCGGAGAGCGCGGCGCTGCAGATGCTGTCGCAG
CTGCTGACGCACAAGCACCTGCACCACGAGATACGCGAGAAGGGGGGCGCGTACGGCGGCGGGGCGTCGTACAAG
CCGCTGGACGGGCTGTTCAGCTTCTACTCGTACCGAGACCCCAACCCGCAGAAGACGCTCGAGGTCATGGGCAAG
GCCGGGCGGTGGGCGGCGGACAAGCAGTGGACGGCGCGGGACATGGAGGAGGCCAAGATCTCGGTGTTCCAGAGC
GTGGACGCGCCGCGGGCGGTGAACCAGGAGGGCATGGCCCGGTTCCTGTCGGGCGTGACGGAGGAGATGAGGCAG
CGGAAGCGGGAGCAGCTGCTGGACGTGACGGCACAAGAGGTGCGGGAGGCGGCGGACAAGTACCTGGCGGCGAGG
ACGGAGGCCGGGGAGGAGCGCGTCGCGTTGCTTGGCGAGAGGCCGGCGTGGGTGAAGGAGGGCTCATGGAAGCTG
CGGCAGATGAAGGTGGCCGGAGGCGGAGGGGCGGACGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail