Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1678
Gene name
LocationContig_138:23276..24789
Strand-
Gene length (bp)1513
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16491 Peptidase_M48_N CAAX prenyl protease N-terminal, five membrane helices 1.7E-64 40 224
PF01435 Peptidase_M48 Peptidase family M48 5.3E-44 227 431

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47154|STE24_YEAST CAAX prenyl protease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE24 PE=1 SV=1 7 432 4.0E-128
sp|Q10071|STE24_SCHPO Probable CAAX prenyl protease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.05 PE=3 SV=1 1 432 5.0E-117
sp|Q8RX88|FACE1_ARATH CAAX prenyl protease 1 homolog OS=Arabidopsis thaliana GN=FACE1 PE=1 SV=1 17 435 3.0E-114
sp|Q6EPN8|FACE1_ORYSJ CAAX prenyl protease 1 homolog OS=Oryza sativa subsp. japonica GN=FACE1 PE=2 SV=1 17 431 4.0E-106
sp|Q80W54|FACE1_MOUSE CAAX prenyl protease 1 homolog OS=Mus musculus GN=Zmpste24 PE=1 SV=2 16 430 6.0E-99
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47154|STE24_YEAST CAAX prenyl protease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE24 PE=1 SV=1 7 432 4.0E-128
sp|Q10071|STE24_SCHPO Probable CAAX prenyl protease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.05 PE=3 SV=1 1 432 5.0E-117
sp|Q8RX88|FACE1_ARATH CAAX prenyl protease 1 homolog OS=Arabidopsis thaliana GN=FACE1 PE=1 SV=1 17 435 3.0E-114
sp|Q6EPN8|FACE1_ORYSJ CAAX prenyl protease 1 homolog OS=Oryza sativa subsp. japonica GN=FACE1 PE=2 SV=1 17 431 4.0E-106
sp|Q80W54|FACE1_MOUSE CAAX prenyl protease 1 homolog OS=Mus musculus GN=Zmpste24 PE=1 SV=2 16 430 6.0E-99
sp|O75844|FACE1_HUMAN CAAX prenyl protease 1 homolog OS=Homo sapiens GN=ZMPSTE24 PE=1 SV=2 17 430 1.0E-96
sp|Q54FH7|FACE1_DICDI CAAX prenyl protease 1 homolog OS=Dictyostelium discoideum GN=zmpste24 PE=3 SV=1 23 433 2.0E-83
sp|Q9XVE5|FACE1_CAEEL CAAX prenyl protease 1 homolog OS=Caenorhabditis elegans GN=fce-1 PE=1 SV=1 20 430 3.0E-72
sp|P40769|YHFN_BACSU Uncharacterized metalloprotease YhfN OS=Bacillus subtilis (strain 168) GN=yhfN PE=3 SV=2 109 428 2.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0008237 metallopeptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0003674 molecular_function No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0008233 peptidase activity No
GO:0071704 organic substance metabolic process No
GO:0004175 endopeptidase activity No
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 119 136 17
2 171 188 17
3 195 217 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1678
MDFLQRLARFLDRPLFPWKKLILGFSVGQYLFETFLTLRQYGVLQRTKPPAVLAKEISQETFDKSQAYGRAKARF
EIASGLWSQIQNVAFIQLDVLPALWSWTGGLLLRWAPARFTGEISHSIVFVMTFIVIQQVLNLPTRLYSTFVLEE
SFGFNKQTPQLFVTDMIKTNLLTAAIMPPILAAFLKIIQKTGNQFVFYLWVFAAGLQLFTTTAYPIFIQPLFNKL
SPLDEGELKTKVEQLAAGHSFPLRELFVIDGSKRSAHSNAYFYGLPWKKHIVIYDTLIEKTETSEIIAILAHELG
HWKLGHTTRLFGIAQAHLLYVFSLFSVFIHNRSLYSAFGFHAQHPIVIGFILFSDALSPMDTVIKLLLNILSRRF
EFEADDFARRLGYPAELAASLIKLHAQNLSTMDADWMYASYHFSHPHLSERLKALDWKPRAAALTTELDKEGVAK
ASGRDEL*
Coding >Hirsu2|1678
ATGGATTTCCTCCAACGCCTCGCCCGCTTCCTCGACCGTCCGCTGTTCCCCTGGAAGAAGCTCATCCTCGGCTTC
TCGGTCGGCCAGTATCTTTTCGAGACGTTCCTCACACTTCGCCAGTACGGCGTGCTGCAGCGGACGAAGCCGCCG
GCCGTGCTGGCCAAGGAGATCTCGCAGGAGACGTTCGACAAGTCGCAGGCGTACGGGCGGGCCAAGGCGCGCTTC
GAGATCGCCAGCGGCCTGTGGTCGCAGATCCAGAATGTCGCCTTCATCCAGCTCGACGTGCTGCCCGCGCTGTGG
TCGTGGACGGGCGGCCTGCTGCTGCGGTGGGCGCCGGCGCGCTTCACGGGCGAGATCAGCCACTCCATCGTCTTC
GTCATGACCTTCATCGTCATCCAGCAGGTGCTGAACCTGCCGACGCGCCTCTACAGCACCTTTGTGCTTGAGGAG
AGCTTCGGCTTCAACAAGCAGACGCCCCAGCTCTTCGTGACCGACATGATCAAGACGAACCTGCTGACGGCCGCC
ATCATGCCGCCCATCCTGGCCGCCTTCCTCAAGATCATCCAGAAGACGGGCAACCAGTTCGTCTTCTACCTCTGG
GTCTTCGCCGCCGGCCTGCAGCTCTTCACCACGACCGCCTACCCCATCTTCATCCAGCCGCTCTTCAACAAGCTG
TCGCCGCTGGACGAGGGCGAGCTCAAGACCAAGGTCGAGCAGCTGGCCGCCGGCCACAGCTTCCCGCTGCGGGAG
CTGTTCGTCATCGACGGCAGCAAGCGCAGCGCCCACTCCAACGCATACTTCTACGGCCTGCCGTGGAAGAAGCAC
ATCGTCATCTACGACACGCTGATCGAGAAGACGGAGACGTCGGAGATCATCGCCATCCTGGCCCACGAGCTCGGC
CACTGGAAGCTCGGCCACACCACCCGCCTCTTCGGCATCGCGCAGGCCCACCTGCTCTACGTCTTCAGCCTCTTC
TCCGTCTTCATCCACAACCGCTCGCTCTACTCGGCCTTTGGCTTCCACGCCCAGCACCCCATCGTCATCGGCTTC
ATCCTCTTCTCCGACGCGCTCTCGCCCATGGACACCGTCATCAAGCTGCTCCTCAACATCCTGTCGCGCCGCTTC
GAGTTCGAGGCCGACGACTTCGCCCGCCGCCTCGGTTACCCCGCCGAGCTGGCCGCCTCGCTCATCAAGCTGCAC
GCGCAGAACCTCAGCACCATGGACGCCGACTGGATGTACGCCAGCTACCACTTCTCCCACCCGCACCTGTCGGAG
CGCCTCAAGGCCCTCGACTGGAAGCCCCGCGCCGCCGCCCTCACCACCGAGCTCGACAAGGAGGGCGTCGCCAAG
GCCAGCGGCCGCGACGAGCTGTAG
Transcript >Hirsu2|1678
ATGGATTTCCTCCAACGCCTCGCCCGCTTCCTCGACCGTCCGCTGTTCCCCTGGAAGAAGCTCATCCTCGGCTTC
TCGGTCGGCCAGTATCTTTTCGAGACGTTCCTCACACTTCGCCAGTACGGCGTGCTGCAGCGGACGAAGCCGCCG
GCCGTGCTGGCCAAGGAGATCTCGCAGGAGACGTTCGACAAGTCGCAGGCGTACGGGCGGGCCAAGGCGCGCTTC
GAGATCGCCAGCGGCCTGTGGTCGCAGATCCAGAATGTCGCCTTCATCCAGCTCGACGTGCTGCCCGCGCTGTGG
TCGTGGACGGGCGGCCTGCTGCTGCGGTGGGCGCCGGCGCGCTTCACGGGCGAGATCAGCCACTCCATCGTCTTC
GTCATGACCTTCATCGTCATCCAGCAGGTGCTGAACCTGCCGACGCGCCTCTACAGCACCTTTGTGCTTGAGGAG
AGCTTCGGCTTCAACAAGCAGACGCCCCAGCTCTTCGTGACCGACATGATCAAGACGAACCTGCTGACGGCCGCC
ATCATGCCGCCCATCCTGGCCGCCTTCCTCAAGATCATCCAGAAGACGGGCAACCAGTTCGTCTTCTACCTCTGG
GTCTTCGCCGCCGGCCTGCAGCTCTTCACCACGACCGCCTACCCCATCTTCATCCAGCCGCTCTTCAACAAGCTG
TCGCCGCTGGACGAGGGCGAGCTCAAGACCAAGGTCGAGCAGCTGGCCGCCGGCCACAGCTTCCCGCTGCGGGAG
CTGTTCGTCATCGACGGCAGCAAGCGCAGCGCCCACTCCAACGCATACTTCTACGGCCTGCCGTGGAAGAAGCAC
ATCGTCATCTACGACACGCTGATCGAGAAGACGGAGACGTCGGAGATCATCGCCATCCTGGCCCACGAGCTCGGC
CACTGGAAGCTCGGCCACACCACCCGCCTCTTCGGCATCGCGCAGGCCCACCTGCTCTACGTCTTCAGCCTCTTC
TCCGTCTTCATCCACAACCGCTCGCTCTACTCGGCCTTTGGCTTCCACGCCCAGCACCCCATCGTCATCGGCTTC
ATCCTCTTCTCCGACGCGCTCTCGCCCATGGACACCGTCATCAAGCTGCTCCTCAACATCCTGTCGCGCCGCTTC
GAGTTCGAGGCCGACGACTTCGCCCGCCGCCTCGGTTACCCCGCCGAGCTGGCCGCCTCGCTCATCAAGCTGCAC
GCGCAGAACCTCAGCACCATGGACGCCGACTGGATGTACGCCAGCTACCACTTCTCCCACCCGCACCTGTCGGAG
CGCCTCAAGGCCCTCGACTGGAAGCCCCGCGCCGCCGCCCTCACCACCGAGCTCGACAAGGAGGGCGTCGCCAAG
GCCAGCGGCCGCGACGAGCTGTAG
Gene >Hirsu2|1678
ATGGATTTCCTCCAAGTACGTCTGGCAATCGCGTTGCCTTGGTCTCGATTGGCGGCCGCCCTCCCCCGTGTCCGG
ACGACGGGGCCCAACGGGGGATGCGCCTGGACGACGACGGCTCGCCTCGTCTCCTTGTCCGTGTGCTGACGGTTC
GCAGCGCCTCGCCCGCTTCCTCGACCGTCCGCTGTTCCCCTGGAAGAAGCTCATCCTCGGCTTCTCGGTCGGCCA
GTATCTTTTCGAGACGTTCCTCACACTTCGCCAGTACGGCGTGCTGCAGCGGACGAAGCCGCCGGCCGTGCTGGC
CAAGGAGATCTCGCAGGAGACGTTCGACAAGTCGCAGGCGTACGGGCGGGCCAAGGCGCGCTTCGAGATCGCCAG
CGGCCTGTGGTCGCAGATCCAGAATGTCGCCTTCATCCAGCTCGACGTGCTGCCCGCGCTGTGGTCGTGGACGGG
CGGCCTGCTGCTGCGGTGGGCGCCGGCGCGCTTCACGGGCGAGATCAGCCACTCCATCGTCTTCGTCATGACCTT
CATCGTCATCCAGCAGGTGCTGAACCTGCCGACGCGCCTCTACAGCACCTTTGTGCTTGAGGAGAGCTTCGGCTT
CAACAAGCAGACGCCCCAGCTCTTCGTGACCGACATGATCAAGACGAACCTGCTGACGGCCGCCATCATGCCGCC
CATCCTGGCCGCCTTCCTCAAGATCATCCAGAAGACGGGCAACCAGTTCGTCTTCTACCTCTGGGTCTTCGCCGC
CGGCCTGCAGCTCTTCACCACGACCGCCTACCCCATCTTCATCCAGCCGCTCTTCAACAAGCTGTCGCCGCTGGA
CGAGGGCGAGCTCAAGACCAAGGTCGAGCAGCTGGCCGCCGGCCACAGCTTCCCGCTGCGGGAGCTGTTCGTCAT
CGACGGCAGCAAGCGCAGCGCCCACTCCAACGCATACTTCTACGGCCTGCCGTGGAAGAAGCACATCGTCATCTA
CGACACGCTGATCGAGAAGACGGAGACGTCGGAGATCATCGCCATCCTGGCCCACGAGCTCGGCCACTGGAAGCT
CGGCCACACCACCCGCCTCTTCGGCATCGCGCAGGCCCACCTGCTCTACGTCTTCAGCCTCTTCTCCGTCTTCAT
CCACAACCGCTCGCTCTACTCGGCCTTTGGCTTCCACGCCCAGCACCCCATCGTCATCGGCTTCATCCTCTTCTC
CGACGCGCTCTCGCCCATGGACACCGTCATCAAGCTGCTCCTCAACATCCTGTCGCGCCGCTTCGAGTTCGAGGC
CGACGACTTCGCCCGCCGCCTCGGTTACCCCGCCGAGCTGGCCGCCTCGCTCATCAAGCTGCACGCGCAGAACCT
CAGCACCATGGACGCCGACTGGATGTACGCCAGCTACCACTTCTCCCACCCGCACCTGTCGGAGCGCCTCAAGGC
CCTCGACTGGAAGCCCCGCGCCGCCGCCCTCACCACCGAGCTCGACAAGGAGGGCGTCGCCAAGGCCAGCGGCCG
CGACGAGCTGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail