Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1667
Gene name
LocationContig_1377:4184..6418
Strand+
Gene length (bp)2234
Transcript length (bp)2091
Coding sequence length (bp)2091
Protein length (aa) 697

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q61282|PGCA_MOUSE Aggrecan core protein OS=Mus musculus GN=Acan PE=1 SV=2 235 677 9.0E-09
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 318 689 3.0E-07
sp|P07897|PGCA_RAT Aggrecan core protein OS=Rattus norvegicus GN=Acan PE=1 SV=2 280 542 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1667
MASHGARGRGAKAKVTALAALMASMAARANEDDPVTVAVTVTTYLDFNAGCLNACPQALPTLEANPHQRPEVPFV
TLTSTGDFAAPTVSTVHPTCDGCQGTVIICKPTDAAAAMAAAPPGAAAIPTLTLPHARPADPTVTLTPAGGGKPP
IAVIGNPAGLANPTVTLPFAGPDDALVTLAPRARGSRPLVIKGDLDGVKKLPKGPLVGADTNGDGIPDVVPGPGG
VVDANGDGKPDFTVLPGGGIDRNGDGKPDGPLPPNAAVDRNGDGKSDYPLVLGPGAVDTNGDGIPDVNAGGFLDL
GGANGGGPKGPGPGGMGPGSPADNNGDGKPNAGAKKPGYPADTNGDGKPDTTVMPDGGIGPGSPVDTNGDGKPDT
TVMPDGGIDKNGDGKPDARLLPGGGVDTTGDGKPDTPVLPGGYVDTDGSGKPDIQIFPKPKEDNGAGKPGPDAPF
VIPVDTNGDGKPDTTVMPGGGIDTDGDGKPDVTLLPGGGVDTNGDGKPDTPVLPGGYIDTDGDGKPDVQLYPTPK
DDKGAGKPGPDMPAVVPVIPVDTNGDGKPDTTVMPGGGIDKNGDGKPDVTLLPGGVVDTNGDGKPDTTVMPGGYI
DTDGDGKPDLQLYPTPRPENSGGGGEPAPNMPSAVPDVPVIPVDNNGDGRPDTTVMPGGGIDKDGDGKPDVTLLP
GGGVDTNGDGKPDTTLPGSQL*
Coding >Hirsu2|1667
ATGGCCTCCCACGGCGCCCGCGGCCGAGGCGCCAAAGCCAAGGTCACGGCCCTGGCCGCACTCATGGCTTCCATG
GCGGCCCGGGCCAACGAGGACGACCCCGTCACCGTCGCCGTCACCGTCACGACCTACCTGGACTTCAACGCCGGC
TGCCTCAACGCCTGCCCGCAGGCGCTCCCGACGCTCGAGGCCAACCCGCACCAGCGACCCGAGGTCCCCTTCGTC
ACGCTGACCTCGACCGGCGACTTCGCCGCGCCGACCGTCTCGACCGTCCACCCCACCTGTGACGGCTGTCAAGGG
ACCGTCATCATCTGCAAGCCGACCGACGCCGCCGCCGCCATGGCCGCCGCTCCCCCGGGCGCCGCCGCGATCCCC
ACCCTGACGCTGCCCCACGCCCGCCCCGCCGACCCGACCGTCACCTTGACGCCGGCCGGCGGGGGCAAGCCGCCC
ATCGCCGTCATCGGCAACCCGGCCGGCCTGGCCAACCCGACCGTCACCCTGCCGTTCGCGGGGCCCGACGACGCG
CTCGTCACGCTGGCCCCCCGCGCCCGGGGCTCGCGGCCGCTCGTCATCAAGGGCGACCTGGACGGCGTGAAGAAG
CTGCCCAAGGGACCCCTCGTCGGCGCCGACACCAACGGTGACGGCATCCCCGACGTCGTCCCCGGCCCGGGCGGC
GTCGTCGACGCCAACGGAGACGGCAAGCCCGACTTCACCGTCCTCCCGGGCGGCGGAATCGACCGCAACGGCGAC
GGCAAGCCTGATGGGCCCTTGCCCCCCAACGCCGCCGTCGACCGCAACGGCGATGGAAAGTCCGACTACCCGCTC
GTCCTCGGCCCCGGCGCCGTCGACACCAACGGCGACGGCATTCCCGACGTGAATGCGGGCGGCTTCCTGGACTTG
GGCGGCGCCAACGGGGGCGGGCCGAAGGGACCAGGCCCCGGCGGCATGGGCCCCGGCTCTCCCGCCGACAACAAC
GGGGATGGAAAGCCCAACGCCGGCGCCAAGAAACCCGGCTATCCCGCCGACACCAACGGCGACGGCAAGCCGGAT
ACGACGGTCATGCCTGACGGTGGCATCGGGCCCGGCTCTCCCGTTGACACCAACGGTGACGGCAAGCCGGATACA
ACGGTCATGCCCGACGGCGGCATCGACAAGAACGGCGACGGCAAGCCCGACGCGCGGCTGCTCCCGGGCGGCGGC
GTCGACACCACCGGCGACGGCAAGCCCGATACCCCGGTCCTCCCGGGCGGCTATGTCGATACCGATGGCAGCGGC
AAGCCGGACATTCAGATCTTCCCCAAGCCTAAGGAAGACAACGGCGCAGGAAAGCCCGGTCCCGACGCGCCGTTC
GTAATTCCGGTGGACACCAACGGTGACGGTAAGCCAGACACGACGGTCATGCCCGGCGGCGGCATCGACACGGAC
GGAGACGGGAAGCCCGATGTTACCCTCCTGCCCGGCGGCGGCGTCGACACCAACGGCGACGGTAAGCCCGATACC
CCGGTCCTGCCCGGTGGCTATATCGATACCGACGGCGATGGGAAGCCGGACGTGCAGCTCTACCCCACGCCTAAG
GACGACAAGGGCGCAGGGAAGCCAGGTCCCGATATGCCGGCTGTGGTTCCCGTGATTCCCGTGGACACCAACGGC
GACGGCAAGCCGGACACGACGGTCATGCCCGGCGGCGGCATCGACAAGAACGGAGACGGCAAGCCCGATGTTACC
CTCCTGCCCGGCGGCGTCGTCGACACCAACGGCGACGGTAAGCCGGACACGACGGTCATGCCCGGCGGCTACATC
GACACCGACGGCGACGGGAAGCCGGATCTTCAGCTCTACCCTACGCCCCGCCCCGAAAACAGCGGCGGAGGAGGG
GAGCCCGCTCCGAATATGCCGTCCGCCGTTCCCGATGTGCCTGTGATTCCCGTGGATAACAACGGCGACGGTAGG
CCAGATACCACGGTCATGCCCGGCGGCGGCATCGACAAGGACGGAGACGGCAAGCCCGATGTCACCCTCCTGCCC
GGCGGCGGCGTCGATACCAACGGCGACGGCAAGCCGGACACGACCTTACCCGGCTCCCAGCTCTAG
Transcript >Hirsu2|1667
ATGGCCTCCCACGGCGCCCGCGGCCGAGGCGCCAAAGCCAAGGTCACGGCCCTGGCCGCACTCATGGCTTCCATG
GCGGCCCGGGCCAACGAGGACGACCCCGTCACCGTCGCCGTCACCGTCACGACCTACCTGGACTTCAACGCCGGC
TGCCTCAACGCCTGCCCGCAGGCGCTCCCGACGCTCGAGGCCAACCCGCACCAGCGACCCGAGGTCCCCTTCGTC
ACGCTGACCTCGACCGGCGACTTCGCCGCGCCGACCGTCTCGACCGTCCACCCCACCTGTGACGGCTGTCAAGGG
ACCGTCATCATCTGCAAGCCGACCGACGCCGCCGCCGCCATGGCCGCCGCTCCCCCGGGCGCCGCCGCGATCCCC
ACCCTGACGCTGCCCCACGCCCGCCCCGCCGACCCGACCGTCACCTTGACGCCGGCCGGCGGGGGCAAGCCGCCC
ATCGCCGTCATCGGCAACCCGGCCGGCCTGGCCAACCCGACCGTCACCCTGCCGTTCGCGGGGCCCGACGACGCG
CTCGTCACGCTGGCCCCCCGCGCCCGGGGCTCGCGGCCGCTCGTCATCAAGGGCGACCTGGACGGCGTGAAGAAG
CTGCCCAAGGGACCCCTCGTCGGCGCCGACACCAACGGTGACGGCATCCCCGACGTCGTCCCCGGCCCGGGCGGC
GTCGTCGACGCCAACGGAGACGGCAAGCCCGACTTCACCGTCCTCCCGGGCGGCGGAATCGACCGCAACGGCGAC
GGCAAGCCTGATGGGCCCTTGCCCCCCAACGCCGCCGTCGACCGCAACGGCGATGGAAAGTCCGACTACCCGCTC
GTCCTCGGCCCCGGCGCCGTCGACACCAACGGCGACGGCATTCCCGACGTGAATGCGGGCGGCTTCCTGGACTTG
GGCGGCGCCAACGGGGGCGGGCCGAAGGGACCAGGCCCCGGCGGCATGGGCCCCGGCTCTCCCGCCGACAACAAC
GGGGATGGAAAGCCCAACGCCGGCGCCAAGAAACCCGGCTATCCCGCCGACACCAACGGCGACGGCAAGCCGGAT
ACGACGGTCATGCCTGACGGTGGCATCGGGCCCGGCTCTCCCGTTGACACCAACGGTGACGGCAAGCCGGATACA
ACGGTCATGCCCGACGGCGGCATCGACAAGAACGGCGACGGCAAGCCCGACGCGCGGCTGCTCCCGGGCGGCGGC
GTCGACACCACCGGCGACGGCAAGCCCGATACCCCGGTCCTCCCGGGCGGCTATGTCGATACCGATGGCAGCGGC
AAGCCGGACATTCAGATCTTCCCCAAGCCTAAGGAAGACAACGGCGCAGGAAAGCCCGGTCCCGACGCGCCGTTC
GTAATTCCGGTGGACACCAACGGTGACGGTAAGCCAGACACGACGGTCATGCCCGGCGGCGGCATCGACACGGAC
GGAGACGGGAAGCCCGATGTTACCCTCCTGCCCGGCGGCGGCGTCGACACCAACGGCGACGGTAAGCCCGATACC
CCGGTCCTGCCCGGTGGCTATATCGATACCGACGGCGATGGGAAGCCGGACGTGCAGCTCTACCCCACGCCTAAG
GACGACAAGGGCGCAGGGAAGCCAGGTCCCGATATGCCGGCTGTGGTTCCCGTGATTCCCGTGGACACCAACGGC
GACGGCAAGCCGGACACGACGGTCATGCCCGGCGGCGGCATCGACAAGAACGGAGACGGCAAGCCCGATGTTACC
CTCCTGCCCGGCGGCGTCGTCGACACCAACGGCGACGGTAAGCCGGACACGACGGTCATGCCCGGCGGCTACATC
GACACCGACGGCGACGGGAAGCCGGATCTTCAGCTCTACCCTACGCCCCGCCCCGAAAACAGCGGCGGAGGAGGG
GAGCCCGCTCCGAATATGCCGTCCGCCGTTCCCGATGTGCCTGTGATTCCCGTGGATAACAACGGCGACGGTAGG
CCAGATACCACGGTCATGCCCGGCGGCGGCATCGACAAGGACGGAGACGGCAAGCCCGATGTCACCCTCCTGCCC
GGCGGCGGCGTCGATACCAACGGCGACGGCAAGCCGGACACGACCTTACCCGGCTCCCAGCTCTAG
Gene >Hirsu2|1667
ATGGCCTCCCACGGCGCCCGCGGCCGAGGCGCCAAAGCCAAGGTCACGGCCCTGGCCGCACTCATGGCTTCCATG
GCGGCCCGGGCCAACGAGGACGACCCCGTCACCGTCGCCGTCACCGTCACGACCTACCTGGACTTCAACGCCGGC
TGCCTCAACGCCTGCCCGCAGGCGCTCCCGACGCTCGAGGCCAACCCGCACCAGCGACCCGAGGTCCCCTTCGTC
ACGCTGACCTCGACCGGCGACTTCGCCGCGCCGACCGTCTCGACCGTCCACCCCACCTGTGACGGCTGTCAAGGG
ACCGTCATCATCTGCAAGCCGACCGACGCCGCCGCCGCCATGGCCGCCGCTCCCCCGGGCGCCGCCGCGATCCCC
ACCCTGACGCTGCCCCACGCCCGCCCCGCCGACCCGACCGTCACCTTGACGCCGGCCGGCGGGGGCAAGCCGCCC
ATCGCCGTCATCGGCAACCCGGCCGGCCTGGCCAACCCGACCGTCACCCTGCCGTTCGCGGGGCCCGACGACGCG
CTCGTCACGCTGGCCCCCCGCGCCCGGGGCTCGCGGCCGCTCGTCATCAAGGGCGACCTGGACGGCGTGAAGAAG
CTGCCCAAGGGACCCCTCGTCGGCGCCGACACCAACGGTGACGGCATCCCCGACGTCGTCCCCGGCCCGGGCGGC
GTCGTCGACGCCAACGGAGACGGCAAGCCCGACTTCACCGTCCTCCCGGGCGGCGGAATCGACCGCAACGGCGAC
GGCAAGCCTGATGGGCCCTTGCCCCCCAACGCCGCCGTCGACCGCAACGGCGATGGAAAGTCCGACTACCCGCTC
GTCCTCGGCCCCGGCGCCGTCGACACCAACGGCGACGGCATTCCCGACGTGAATGCGGGCGGCTTCCTGGACTTG
GGCGGCGCCAACGGGGGCGGGCCGAAGGGACCAGGCCCCGGCGGCATGGGCCCCGGCTCTCCCGCCGACAACAAC
GGGGATGGAAAGCCCAACGCCGGCGCCAAGAAACCCGGCTATCCCGCCGACACCAACGGCGACGGCAAGCCGGAT
ACGACGGTCATGCCTGACGGTGGCATCGGGCCCGGCTCTCCCGTTGACACCAACGGTGACGGCAAGCCGGATACA
ACGGTCATGCCCGACGGCGGCATCGACAAGAACGGCGACGGCAAGCCCGACGCGCGGCTGCTCCCGGGCGGCGGC
GTCGACACCACCGGCGACGGCAAGCCCGATACCCCGGTCCTCCCGGGCGGCTATGTCGATACCGATGGCAGCGGC
AAGCCGGACATTCAGATCTTCCCCAAGCCTAAGGAAGACAACGGCGCAGGAAAGCCCGGTCCCGACGCGCCGTTC
GTAATTCCGGTGGACACCAACGGTGACGGTAAGCCAGACACGACGGTCATGCCCGGCGGCGGCATCGACACGGAC
GGAGACGGGAAGCCCGATGTTACCCTCCTGCCCGGCGGCGGCGTCGACACCAACGGCGACGGTAAGCCCGATACC
CCGGTCCTGCCCGGTGGCTATATCGATACCGACGGCGATGGGAAGCCGGACGTGCAGCTCTACCCCACGCCTAAG
GACGACAAGGGCGCAGGGAAGCCAGGTCCCGATATGCCGGCTGTGGTTCCCGTGATTCCCGTGGACACCAACGGC
GACGGCAAGCCGGACACGACGGTCATGCCCGGCGGCGGCATCGACAAGAACGGAGACGGCAAGCCCGATGTTACC
CTCCTGCCCGGCGGCGTCGTCGACACCAACGGCGACGGTAAGCCGGACACGACGGTCATGCCCGGCGGCTACATC
GACACCGACGGCGACGGGAAGCCGGATCTTCAGCTCTACCCTACGCCCCGCCCCGAAAACAGCGGCGGAGGAGGG
GAGCCCGCTCCGAATATGCCGTCCGCCGTTCCCGATGTGCCTGTGATTCCCGTGGATAACAACGGCGACGGTAGG
CCAGATACCACGGTCATGCCCGGCGGCGGCATCGACAAGGACGGAGACGGCAAGCCCGATGTCACCCTCCTGCCC
GGCGGCGGCGTCGATACCAACGGCGACGGCAAGCCGGACACGACCGTCGGGCCCGGCGGCTACATCGACACCGAC
GGCGACGGCAAGCCGGATCTTCAGCTCTATCCCACGCCCCGCCCCGGGAAGACTTCCACTCCGAATGCTGGCAAC
CCGCCTCCCAGCTCGAGTTACTCGCCTCCCCGCTCCAGTTACCCGGCTCCCAGCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail