Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1662
Gene name
LocationContig_1376:2028..3480
Strand-
Gene length (bp)1452
Transcript length (bp)1452
Coding sequence length (bp)1452
Protein length (aa) 484

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02934 GatB_N GatB/GatE catalytic domain 1.3E-81 1 252
PF02637 GatB_Yqey GatB domain 5.2E-11 323 474

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7YPY3|GATB_NECH7 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_39102 PE=3 SV=1 1 481 0.0E+00
sp|C9SFZ6|GATB_VERA1 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_03509 PE=3 SV=1 1 479 0.0E+00
sp|Q7S2V0|GATB_NEUCR Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU09025 PE=3 SV=1 1 482 0.0E+00
sp|B2AL82|GATB_PODAN Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_5_9870 PE=3 SV=2 1 483 0.0E+00
sp|A4R713|GATB_MAGO7 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_03390 PE=3 SV=1 1 477 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7YPY3|GATB_NECH7 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_39102 PE=3 SV=1 1 481 0.0E+00
sp|C9SFZ6|GATB_VERA1 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_03509 PE=3 SV=1 1 479 0.0E+00
sp|Q7S2V0|GATB_NEUCR Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU09025 PE=3 SV=1 1 482 0.0E+00
sp|B2AL82|GATB_PODAN Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_5_9870 PE=3 SV=2 1 483 0.0E+00
sp|A4R713|GATB_MAGO7 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_03390 PE=3 SV=1 1 477 0.0E+00
sp|C5G7E1|GATB_AJEDR Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_00769 PE=3 SV=1 1 473 2.0E-155
sp|C5JUE6|GATB_AJEDS Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_06294 PE=3 SV=1 1 473 2.0E-155
sp|C6HRN2|GATB_AJECH Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Ajellomyces capsulatus (strain H143) GN=HCDG_08617 PE=3 SV=2 1 473 5.0E-153
sp|C1GTX5|GATB_PARBA Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_01970 PE=3 SV=2 1 473 1.0E-151
sp|Q208S2|GATB_PARBR Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Paracoccidioides brasiliensis PE=2 SV=1 1 473 3.0E-151
sp|C1G198|GATB_PARBD Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_00638 PE=3 SV=2 1 473 3.0E-151
sp|A1D6S8|GATB_NEOFI Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_065860 PE=3 SV=1 1 478 3.0E-150
sp|Q4WY16|GATB_ASPFU Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G11440 PE=3 SV=2 1 478 3.0E-150
sp|B0XXK5|GATB_ASPFC Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_037730 PE=3 SV=2 1 478 1.0E-149
sp|Q33446|GATB_EMENI Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nempA PE=3 SV=3 1 479 6.0E-148
sp|B6H4I3|GATB_PENRW Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc13g09720 PE=3 SV=1 1 478 3.0E-146
sp|B6Q348|GATB_TALMQ Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_019330 PE=3 SV=1 1 478 1.0E-145
sp|B8M501|GATB_TALSN Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_027330 PE=3 SV=1 1 473 2.0E-144
sp|A1CKP5|GATB_ASPCL Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_039340 PE=3 SV=1 1 478 2.0E-143
sp|C5FS59|GATB_ARTOC Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_05531 PE=3 SV=1 1 474 9.0E-141
sp|Q2UKS0|GATB_ASPOR Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090003000698 PE=3 SV=1 1 478 2.0E-133
sp|B8N3N5|GATB_ASPFN Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_031190 PE=3 SV=1 1 478 2.0E-133
sp|A2QDI9|GATB_ASPNC Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g07260 PE=3 SV=1 1 473 3.0E-131
sp|C0NV09|GATB_AJECG Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_06773 PE=3 SV=2 1 473 1.0E-129
sp|Q1RHE8|GATB_RICBR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia bellii (strain RML369-C) GN=gatB PE=3 SV=1 1 387 1.0E-73
sp|Q4P525|GATB_USTMA Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10688 PE=3 SV=2 2 387 1.0E-72
sp|A8GV45|GATB_RICB8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia bellii (strain OSU 85-389) GN=gatB PE=3 SV=1 1 387 2.0E-72
sp|A5CEC9|GATB_ORITB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Orientia tsutsugamushi (strain Boryong) GN=gatB PE=3 SV=1 1 456 4.0E-72
sp|B3CQQ8|GATB_ORITI Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Orientia tsutsugamushi (strain Ikeda) GN=gatB PE=3 SV=1 1 480 8.0E-72
sp|Q1QL34|GATB_NITHX Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gatB PE=3 SV=1 1 387 2.0E-71
sp|A8EXM0|GATB_RICCK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia canadensis (strain McKiel) GN=gatB PE=3 SV=1 1 456 3.0E-71
sp|C4R8P2|GATB_PICPG Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PET112 PE=3 SV=1 1 480 8.0E-71
sp|Q68XL7|GATB_RICTY Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=gatB PE=3 SV=1 1 387 1.0E-70
sp|Q3AD35|GATB_CARHZ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=gatB PE=3 SV=1 1 479 2.0E-70
sp|Q2ND71|GATB_ERYLH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Erythrobacter litoralis (strain HTCC2594) GN=gatB PE=3 SV=1 1 476 2.0E-70
sp|Q9ZE11|GATB_RICPR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia prowazekii (strain Madrid E) GN=gatB PE=3 SV=1 1 478 3.0E-70
sp|Q4UKF0|GATB_RICFE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=gatB PE=3 SV=1 1 387 7.0E-70
sp|Q92J76|GATB_RICCN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=gatB PE=3 SV=1 1 387 7.0E-70
sp|B0BWC2|GATB_RICRO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia rickettsii (strain Iowa) GN=gatB PE=3 SV=1 1 387 9.0E-70
sp|A8GQX6|GATB_RICRS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia rickettsii (strain Sheila Smith) GN=gatB PE=3 SV=1 1 387 9.0E-70
sp|C3PMI9|GATB_RICAE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia africae (strain ESF-5) GN=gatB PE=3 SV=1 1 387 1.0E-69
sp|A5EKP2|GATB_BRASB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gatB PE=3 SV=1 1 387 1.0E-69
sp|Q2GKN0|GATB_ANAPZ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Anaplasma phagocytophilum (strain HZ) GN=gatB PE=3 SV=1 1 476 1.0E-69
sp|C4K0R5|GATB_RICPU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia peacockii (strain Rustic) GN=gatB PE=3 SV=1 1 387 2.0E-69
sp|P61347|GATB_RHOPA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=gatB PE=3 SV=1 1 387 3.0E-69
sp|A5DWJ3|GATB_LODEL Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PET112 PE=3 SV=1 1 286 6.0E-69
sp|Q0BTK1|GATB_GRABC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=gatB PE=3 SV=1 1 316 8.0E-69
sp|Q5KEG8|GATB_CRYNJ Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNG00570 PE=3 SV=1 1 387 1.0E-68
sp|C4YE90|GATB_CANAW Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Candida albicans (strain WO-1) GN=PET112 PE=3 SV=1 1 273 2.0E-68
sp|Q5A9Z1|GATB_CANAL Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PET112 PE=3 SV=1 1 273 2.0E-68
sp|A7TI41|GATB_VANPO Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=PET112 PE=3 SV=1 1 416 2.0E-68
sp|A5FWV7|GATB_ACICJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Acidiphilium cryptum (strain JF-5) GN=gatB PE=3 SV=1 1 476 6.0E-68
sp|Q2GG24|GATB_EHRCR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=gatB PE=3 SV=1 1 478 6.0E-68
sp|B9W7X4|GATB_CANDC Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=PET112 PE=3 SV=1 1 273 6.0E-68
sp|Q89K31|GATB_BRADU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gatB PE=3 SV=1 1 387 7.0E-68
sp|A8F5H5|GATB_PSELT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=gatB PE=3 SV=1 2 456 7.0E-68
sp|Q5PB50|GATB_ANAMM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Anaplasma marginale (strain St. Maries) GN=gatB PE=3 SV=1 1 387 8.0E-68
sp|Q3YSJ0|GATB_EHRCJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ehrlichia canis (strain Jake) GN=gatB PE=3 SV=1 1 478 9.0E-68
sp|B5YL60|GATB_THEYD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=gatB PE=3 SV=1 1 337 1.0E-67
sp|Q215W3|GATB_RHOPB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodopseudomonas palustris (strain BisB18) GN=gatB PE=3 SV=1 1 387 2.0E-67
sp|B0KBN3|GATB_THEP3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gatB PE=3 SV=1 1 456 2.0E-67
sp|B0K3S4|GATB_THEPX Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermoanaerobacter sp. (strain X514) GN=gatB PE=3 SV=1 1 456 2.0E-67
sp|C0QUH9|GATB_PERMH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=gatB PE=3 SV=1 1 456 3.0E-67
sp|Q67KJ3|GATB_SYMTH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=gatB PE=3 SV=1 1 456 3.0E-67
sp|Q751Q9|GATB_ASHGO Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PET112 PE=3 SV=1 1 474 3.0E-67
sp|Q4ZNS6|GATB_PSEU2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas syringae pv. syringae (strain B728a) GN=gatB PE=3 SV=1 1 478 3.0E-67
sp|B8IL55|GATB_METNO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=gatB PE=3 SV=1 1 476 4.0E-67
sp|B9KI71|GATB_ANAMF Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Anaplasma marginale (strain Florida) GN=gatB PE=3 SV=1 1 387 4.0E-67
sp|Q3SR35|GATB_NITWN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gatB PE=3 SV=1 1 387 5.0E-67
sp|A8ICV0|GATB_AZOC5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=gatB PE=3 SV=1 1 316 1.0E-66
sp|Q87WR8|GATB_PSESM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gatB PE=3 SV=1 1 478 3.0E-66
sp|B6JFW6|GATB_OLICO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=gatB PE=3 SV=1 1 476 3.0E-66
sp|Q2IXB5|GATB_RHOP2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodopseudomonas palustris (strain HaA2) GN=gatB PE=3 SV=1 1 387 4.0E-66
sp|Q48E91|GATB_PSE14 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=gatB PE=3 SV=1 1 478 5.0E-66
sp|Q3KI28|GATB_PSEPF Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas fluorescens (strain Pf0-1) GN=gatB PE=3 SV=1 1 478 6.0E-66
sp|B0KQF9|GATB_PSEPG Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas putida (strain GB-1) GN=gatB PE=3 SV=1 1 478 7.0E-66
sp|Q07L96|GATB_RHOP5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodopseudomonas palustris (strain BisA53) GN=gatB PE=3 SV=1 1 387 7.0E-66
sp|Q4KIA9|GATB_PSEF5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=gatB PE=3 SV=1 1 478 7.0E-66
sp|Q8RC39|GATB_CALS4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gatB PE=3 SV=1 1 456 7.0E-66
sp|A5VZ21|GATB_PSEP1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=gatB PE=3 SV=1 1 478 9.0E-66
sp|A5CZ96|GATB_PELTS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=gatB PE=3 SV=1 1 456 9.0E-66
sp|B1JDP2|GATB_PSEPW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas putida (strain W619) GN=gatB PE=3 SV=1 1 478 9.0E-66
sp|Q5NPF4|GATB_ZYMMO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gatB PE=3 SV=2 1 334 9.0E-66
sp|C5MFG4|GATB_CANTT Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=PET112 PE=3 SV=1 1 273 1.0E-65
sp|Q135J9|GATB_RHOPS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodopseudomonas palustris (strain BisB5) GN=gatB PE=3 SV=1 1 387 1.0E-65
sp|B1LUB2|GATB_METRJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=gatB PE=3 SV=1 1 476 2.0E-65
sp|Q2G4F6|GATB_NOVAD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=gatB PE=3 SV=1 1 476 2.0E-65
sp|B0UHC4|GATB_METS4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methylobacterium sp. (strain 4-46) GN=gatB PE=3 SV=1 1 387 2.0E-65
sp|Q88PC0|GATB_PSEPK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas putida (strain KT2440) GN=gatB PE=3 SV=1 1 478 2.0E-65
sp|A5V3U9|GATB_SPHWW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=gatB PE=3 SV=1 1 334 2.0E-65
sp|Q1IED4|GATB_PSEE4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas entomophila (strain L48) GN=gatB PE=3 SV=1 1 478 3.0E-65
sp|Q6FXR9|GATB_CANGA Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PET112 PE=3 SV=1 1 473 4.0E-65
sp|C3K6Y3|GATB_PSEFS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas fluorescens (strain SBW25) GN=gatB PE=3 SV=1 1 478 4.0E-65
sp|B1ZIK6|GATB_METPB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gatB PE=3 SV=1 1 387 6.0E-65
sp|Q8DGC4|GATB_THEEB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermosynechococcus elongatus (strain BP-1) GN=gatB PE=3 SV=1 1 476 8.0E-65
sp|A7IMA9|GATB_XANP2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gatB PE=3 SV=1 1 316 9.0E-65
sp|C5DQW8|GATB_ZYGRC Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=PET112 PE=3 SV=1 1 458 9.0E-65
sp|Q6BT30|GATB_DEBHA Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PET112 PE=3 SV=2 1 456 1.0E-64
sp|C3MAA7|GATB_RHISN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhizobium sp. (strain NGR234) GN=gatB PE=3 SV=1 1 397 2.0E-64
sp|P61341|GATB_BDEBA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gatB PE=3 SV=1 1 387 5.0E-64
sp|B7KTR5|GATB_METC4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=gatB PE=3 SV=1 1 387 7.0E-64
sp|Q16UG2|GATB_AEDAE Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Aedes aegypti GN=AAEL009908 PE=3 SV=1 1 473 8.0E-64
sp|O66766|GATB_AQUAE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Aquifex aeolicus (strain VF5) GN=gatB PE=1 SV=1 1 477 1.0E-63
sp|Q11HL0|GATB_CHESB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chelativorans sp. (strain BNC1) GN=gatB PE=3 SV=1 1 435 1.0E-63
sp|A9VWZ8|GATB_METEP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methylobacterium extorquens (strain PA1) GN=gatB PE=3 SV=1 1 387 1.0E-63
sp|A6U821|GATB_SINMW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Sinorhizobium medicae (strain WSM419) GN=gatB PE=3 SV=1 1 397 2.0E-63
sp|B3CN64|GATB_WOLPP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=gatB PE=3 SV=1 1 456 2.0E-63
sp|Q99JT1|GATB_MOUSE Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Mus musculus GN=Gatb PE=1 SV=1 1 476 2.0E-63
sp|Q5HBP2|GATB_EHRRW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ehrlichia ruminantium (strain Welgevonden) GN=gatB PE=3 SV=1 1 477 2.0E-63
sp|A5DE65|GATB_PICGU Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PET112 PE=3 SV=2 1 425 2.0E-63
sp|A2BZG6|GATB_PROM1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prochlorococcus marinus (strain NATL1A) GN=gatB PE=3 SV=1 1 478 2.0E-63
sp|Q5FHD2|GATB_EHRRG Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ehrlichia ruminantium (strain Gardel) GN=gatB PE=3 SV=1 1 477 3.0E-63
sp|Q46I09|GATB_PROMT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prochlorococcus marinus (strain NATL2A) GN=gatB PE=3 SV=1 1 478 3.0E-63
sp|C0R5B9|GATB_WOLWR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=gatB PE=3 SV=1 1 476 3.0E-63
sp|Q9X100|GATB_THEMA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gatB PE=1 SV=1 2 286 4.0E-63
sp|Q8ES77|GATB_OCEIH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=gatB PE=3 SV=1 2 456 4.0E-63
sp|A4VIA8|GATB_PSEU5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas stutzeri (strain A1501) GN=gatB PE=3 SV=1 1 478 4.0E-63
sp|C1DQ36|GATB_AZOVD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=gatB PE=3 SV=1 1 478 4.0E-63
sp|A4XQK5|GATB_PSEMY Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas mendocina (strain ymp) GN=gatB PE=3 SV=1 1 478 7.0E-63
sp|Q2RGY5|GATB_MOOTA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Moorella thermoacetica (strain ATCC 39073) GN=gatB PE=3 SV=1 1 476 7.0E-63
sp|P61349|GATB_WOLPM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Wolbachia pipientis wMel GN=gatB PE=3 SV=1 1 476 8.0E-63
sp|Q9A5L1|GATB_CAUCR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=gatB PE=3 SV=1 1 387 1.0E-62
sp|C3KU96|GATB_CLOB6 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium botulinum (strain 657 / Type Ba4) GN=gatB PE=3 SV=1 1 387 1.0E-62
sp|B0CXE1|GATB_LACBS Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_231681 PE=3 SV=1 1 295 2.0E-62
sp|Q8UFS3|GATB_AGRFC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=gatB PE=3 SV=2 1 387 2.0E-62
sp|C5DE55|GATB_LACTC Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=PET112 PE=3 SV=1 1 473 2.0E-62
sp|A4XHY9|GATB_CALS8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=gatB PE=3 SV=1 1 387 2.0E-62
sp|Q8R680|GATB_FUSNN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=gatB PE=3 SV=1 2 458 2.0E-62
sp|A1AW14|GATB_RUTMC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ruthia magnifica subsp. Calyptogena magnifica GN=gatB PE=3 SV=1 1 476 2.0E-62
sp|A6QAM1|GATB_SULNB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Sulfurovum sp. (strain NBC37-1) GN=gatB PE=3 SV=1 1 476 2.0E-62
sp|Q60CK9|GATB_METCA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gatB PE=3 SV=1 1 477 3.0E-62
sp|B1LC74|GATB_THESQ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermotoga sp. (strain RQ2) GN=gatB PE=3 SV=1 2 286 3.0E-62
sp|A8LI95|GATB_DINSH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=gatB PE=3 SV=1 1 387 3.0E-62
sp|A5IMT3|GATB_THEP1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=gatB PE=3 SV=1 2 286 3.0E-62
sp|B9K942|GATB_THENN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=gatB PE=3 SV=1 2 286 3.0E-62
sp|B0W3H3|GATB_CULQU Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Culex quinquefasciatus GN=CPIJ001717 PE=3 SV=1 1 436 3.0E-62
sp|B3PXX8|GATB_RHIE6 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhizobium etli (strain CIAT 652) GN=gatB PE=3 SV=1 1 397 4.0E-62
sp|A3GFV6|GATB_PICST Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PET112 PE=3 SV=1 1 390 5.0E-62
sp|Q2K933|GATB_RHIEC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gatB PE=3 SV=1 1 397 7.0E-62
sp|Q92QK5|GATB_RHIME Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhizobium meliloti (strain 1021) GN=gatB PE=3 SV=2 1 397 7.0E-62
sp|B9MQ85|GATB_CALBD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=gatB PE=3 SV=1 1 387 9.0E-62
sp|Q97FQ8|GATB1_CLOAB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B 1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gatB1 PE=3 SV=1 1 456 1.0E-61
sp|C5BSY9|GATB_TERTT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=gatB PE=3 SV=1 1 478 1.0E-61
sp|B5ZMJ6|GATB_RHILW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=gatB PE=3 SV=1 1 397 1.0E-61
sp|A1USB4|GATB_BARBK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=gatB PE=3 SV=1 1 477 1.0E-61
sp|Q4FLQ8|GATB_PELUB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pelagibacter ubique (strain HTCC1062) GN=gatB PE=3 SV=1 1 477 2.0E-61
sp|B3EP77|GATB_CHLPB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chlorobium phaeobacteroides (strain BS1) GN=gatB PE=3 SV=1 1 478 2.0E-61
sp|B9JVJ7|GATB_AGRVS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=gatB PE=3 SV=1 1 397 2.0E-61
sp|A5I6Z2|GATB_CLOBH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=gatB PE=3 SV=1 1 387 2.0E-61
sp|A7FYL2|GATB_CLOB1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=gatB PE=3 SV=1 1 387 2.0E-61
sp|Q6CMF5|GATB_KLULA Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PET112 PE=3 SV=1 1 423 2.0E-61
sp|Q2SBG4|GATB_HAHCH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Hahella chejuensis (strain KCTC 2396) GN=gatB PE=3 SV=1 1 476 2.0E-61
sp|C0Z4E5|GATB_BREBN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=gatB PE=3 SV=1 2 387 2.0E-61
sp|B1L1G8|GATB_CLOBM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=gatB PE=3 SV=1 1 387 2.0E-61
sp|Q3A2J9|GATB_PELCD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=gatB PE=3 SV=1 1 478 2.0E-61
sp|Q3J4Z8|GATB_RHOS4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=gatB PE=3 SV=1 1 387 2.0E-61
sp|Q31F54|GATB_THICR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thiomicrospira crunogena (strain XCL-2) GN=gatB PE=3 SV=1 1 477 2.0E-61
sp|Q1MHI9|GATB_RHIL3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=gatB PE=3 SV=1 1 397 3.0E-61
sp|A9ISC3|GATB_BART1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gatB PE=3 SV=1 1 397 5.0E-61
sp|Q8KAE8|GATB_CHLTE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=gatB PE=3 SV=1 1 355 5.0E-61
sp|B6IPU4|GATB_RHOCS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=gatB PE=3 SV=1 1 316 6.0E-61
sp|B8GL96|GATB_THISH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=gatB PE=3 SV=1 1 477 6.0E-61
sp|B0BZQ6|GATB_ACAM1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Acaryochloris marina (strain MBIC 11017) GN=gatB PE=3 SV=1 1 478 8.0E-61
sp|A5GPE6|GATB_SYNPW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechococcus sp. (strain WH7803) GN=gatB PE=3 SV=1 1 478 9.0E-61
sp|Q2RPH5|GATB_RHORT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=gatB PE=3 SV=1 1 478 9.0E-61
sp|Q98ND3|GATB_RHILO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhizobium loti (strain MAFF303099) GN=gatB PE=3 SV=1 1 387 1.0E-60
sp|B3QRD6|GATB_CHLP8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chlorobaculum parvum (strain NCIB 8327) GN=gatB PE=3 SV=1 1 355 1.0E-60
sp|A4WX55|GATB_RHOS5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=gatB PE=3 SV=1 1 387 1.0E-60
sp|Q0ACB6|GATB_ALKEH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gatB PE=3 SV=1 1 477 1.0E-60
sp|P64198|GATB_BRUSU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brucella suis biovar 1 (strain 1330) GN=gatB PE=3 SV=1 1 397 1.0E-60
sp|P64197|GATB_BRUME Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gatB PE=3 SV=1 1 397 1.0E-60
sp|C0RIN3|GATB_BRUMB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gatB PE=3 SV=1 1 397 1.0E-60
sp|A9MAS2|GATB_BRUC2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gatB PE=3 SV=1 1 397 1.0E-60
sp|Q57DK8|GATB_BRUAB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brucella abortus biovar 1 (strain 9-941) GN=gatB PE=3 SV=1 1 397 1.0E-60
sp|Q2YNL2|GATB_BRUA2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brucella abortus (strain 2308) GN=gatB PE=3 SV=1 1 397 1.0E-60
sp|B2S5D2|GATB_BRUA1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brucella abortus (strain S19) GN=gatB PE=3 SV=1 1 397 1.0E-60
sp|Q5LPK1|GATB_RUEPO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=gatB PE=3 SV=1 1 387 1.0E-60
sp|B0CLM5|GATB_BRUSI Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gatB PE=3 SV=1 1 397 2.0E-60
sp|Q891I2|GATB_CLOTE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium tetani (strain Massachusetts / E88) GN=gatB PE=3 SV=1 1 387 2.0E-60
sp|Q7T010|GATB_DANRE Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Danio rerio GN=gatb PE=3 SV=2 1 300 2.0E-60
sp|B3QTR8|GATB_CHLT3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=gatB PE=3 SV=1 1 281 2.0E-60
sp|A3PHJ3|GATB_RHOS1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=gatB PE=3 SV=1 1 387 2.0E-60
sp|Q02GV7|GATB_PSEAB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=gatB PE=3 SV=1 1 477 2.0E-60
sp|A6VBJ9|GATB_PSEA7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas aeruginosa (strain PA7) GN=gatB PE=3 SV=1 1 478 3.0E-60
sp|B9KMT6|GATB_RHOSK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=gatB PE=3 SV=1 1 387 3.0E-60
sp|Q5GRT2|GATB_WOLTR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=gatB PE=3 SV=1 1 457 3.0E-60
sp|B8FJV3|GATB_DESAA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Desulfatibacillum alkenivorans (strain AK-01) GN=gatB PE=3 SV=1 1 387 3.0E-60
sp|B2IEA3|GATB_BEII9 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gatB PE=3 SV=1 1 403 4.0E-60
sp|Q9HVT7|GATB_PSEAE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gatB PE=1 SV=1 1 477 4.0E-60
sp|B7V024|GATB_PSEA8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas aeruginosa (strain LESB58) GN=gatB PE=3 SV=1 1 477 4.0E-60
sp|P61343|GATB_GEOSL Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gatB PE=3 SV=1 1 478 4.0E-60
sp|A5VQ81|GATB_BRUO2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gatB PE=3 SV=1 1 397 5.0E-60
sp|Q5FND4|GATB_GLUOX Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Gluconobacter oxydans (strain 621H) GN=gatB PE=3 SV=1 1 277 5.0E-60
sp|Q6G3Y7|GATB_BARHE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gatB PE=3 SV=1 1 387 7.0E-60
sp|Q2JXB3|GATB_SYNJA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechococcus sp. (strain JA-3-3Ab) GN=gatB PE=3 SV=1 1 478 8.0E-60
sp|Q3AGQ3|GATB_SYNSC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechococcus sp. (strain CC9605) GN=gatB PE=3 SV=1 1 477 9.0E-60
sp|B1INF6|GATB_CLOBK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium botulinum (strain Okra / Type B1) GN=gatB PE=3 SV=1 1 387 1.0E-59
sp|Q6FZK7|GATB_BARQU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bartonella quintana (strain Toulouse) GN=gatB PE=3 SV=1 1 397 1.0E-59
sp|Q3APF2|GATB_CHLCH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chlorobium chlorochromatii (strain CaD3) GN=gatB PE=3 SV=1 1 478 1.0E-59
sp|B9LZ19|GATB_GEODF Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=gatB PE=3 SV=1 1 478 2.0E-59
sp|Q28R79|GATB_JANSC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Jannaschia sp. (strain CCS1) GN=gatB PE=3 SV=1 1 387 2.0E-59
sp|Q31S19|GATB_SYNE7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechococcus elongatus (strain PCC 7942) GN=gatB PE=3 SV=1 1 478 2.0E-59
sp|B3EHE8|GATB_CHLL2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=gatB PE=3 SV=1 1 355 2.0E-59
sp|Q3AVV7|GATB_SYNS9 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechococcus sp. (strain CC9902) GN=gatB PE=3 SV=1 1 478 2.0E-59
sp|C6E6Z3|GATB_GEOSM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacter sp. (strain M21) GN=gatB PE=3 SV=1 1 478 2.0E-59
sp|B8EPC0|GATB_METSB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=gatB PE=3 SV=1 1 286 2.0E-59
sp|A0Q2P9|GATB_CLONN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium novyi (strain NT) GN=gatB PE=3 SV=1 1 387 3.0E-59
sp|Q49092|GATB_MORCA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Moraxella catarrhalis GN=gatB PE=3 SV=2 1 476 3.0E-59
sp|Q7U3S3|GATB_SYNPX Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechococcus sp. (strain WH8102) GN=gatB PE=3 SV=1 1 478 3.0E-59
sp|Q9Z9X0|GATB_BACHD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gatB PE=3 SV=1 2 387 3.0E-59
sp|A6X191|GATB_OCHA4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gatB PE=3 SV=1 1 397 4.0E-59
sp|B7H4W3|GATB_BACC4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cereus (strain B4264) GN=gatB PE=3 SV=1 2 387 4.0E-59
sp|B2TJ00|GATB_CLOBB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=gatB PE=3 SV=1 1 436 4.0E-59
sp|A5G9J8|GATB_GEOUR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacter uraniireducens (strain Rf4) GN=gatB PE=3 SV=1 1 478 4.0E-59
sp|C4Z3J5|GATB_EUBE2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=gatB PE=3 SV=1 1 387 4.0E-59
sp|C1FLD8|GATB_CLOBJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium botulinum (strain Kyoto / Type A2) GN=gatB PE=3 SV=1 1 387 4.0E-59
sp|Q2GEW1|GATB_NEOSM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Neorickettsia sennetsu (strain Miyayama) GN=gatB PE=3 SV=1 1 437 4.0E-59
sp|Q82T56|GATB_NITEU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gatB PE=3 SV=1 1 476 5.0E-59
sp|A7GIK1|GATB_CLOBL Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=gatB PE=3 SV=1 1 387 7.0E-59
sp|B2UZ27|GATB_CLOBA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=gatB PE=3 SV=1 1 387 7.0E-59
sp|Q6FDY4|GATB_ACIAD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=gatB PE=3 SV=1 1 473 9.0E-59
sp|B3PC09|GATB_CELJU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Cellvibrio japonicus (strain Ueda107) GN=gatB PE=3 SV=1 1 456 1.0E-58
sp|C1EV89|GATB_BACC3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cereus (strain 03BB102) GN=gatB PE=3 SV=1 2 387 1.0E-58
sp|B7JMB3|GATB_BACC0 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cereus (strain AH820) GN=gatB PE=3 SV=1 2 387 1.0E-58
sp|Q81ZE7|GATB_BACAN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus anthracis GN=gatB PE=3 SV=1 2 387 1.0E-58
sp|A0R922|GATB_BACAH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus thuringiensis (strain Al Hakam) GN=gatB PE=3 SV=1 2 387 1.0E-58
sp|C3L560|GATB_BACAC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=gatB PE=3 SV=1 2 387 1.0E-58
sp|C3PBQ5|GATB_BACAA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus anthracis (strain A0248) GN=gatB PE=3 SV=1 2 387 1.0E-58
sp|B8I602|GATB_CLOCE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=gatB PE=3 SV=1 1 480 1.0E-58
sp|Q163L1|GATB_ROSDO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=gatB PE=3 SV=1 1 391 1.0E-58
sp|B7HSY1|GATB_BACC7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cereus (strain AH187) GN=gatB PE=3 SV=1 2 387 1.0E-58
sp|Q73EK7|GATB_BACC1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gatB PE=3 SV=1 2 387 1.0E-58
sp|Q7V3M7|GATB_PROMP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=gatB PE=3 SV=1 1 476 2.0E-58
sp|Q63GQ9|GATB_BACCZ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cereus (strain ZK / E33L) GN=gatB PE=3 SV=1 2 387 2.0E-58
sp|Q81IN2|GATB_BACCR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=gatB PE=3 SV=1 2 387 2.0E-58
sp|B9J1N1|GATB_BACCQ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cereus (strain Q1) GN=gatB PE=3 SV=1 2 387 2.0E-58
sp|C8Z3R4|GATB_YEAS8 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=PET112 PE=3 SV=1 1 393 2.0E-58
sp|B5VDR1|GATB_YEAS6 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=PET112 PE=3 SV=1 1 393 2.0E-58
sp|C7GK54|GATB_YEAS2 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=PET112 PE=3 SV=1 1 393 2.0E-58
sp|B3LNL2|GATB_YEAS1 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=PET112 PE=3 SV=1 1 393 2.0E-58
sp|Q3M629|GATB_ANAVT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gatB PE=3 SV=1 1 478 3.0E-58
sp|B2T1M5|GATB_BURPP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=gatB PE=3 SV=1 1 476 3.0E-58
sp|Q5N294|GATB_SYNP6 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gatB PE=3 SV=1 1 478 3.0E-58
sp|A1BJ58|GATB_CHLPD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chlorobium phaeobacteroides (strain DSM 266) GN=gatB PE=3 SV=1 1 336 3.0E-58
sp|B7KGN0|GATB_CYAP7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Cyanothece sp. (strain PCC 7424) GN=gatB PE=3 SV=1 2 478 4.0E-58
sp|Q6HP80|GATB_BACHK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gatB PE=3 SV=1 2 387 4.0E-58
sp|Q2JNH3|GATB_SYNJB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=gatB PE=3 SV=1 1 478 4.0E-58
sp|B7IUY0|GATB_BACC2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cereus (strain G9842) GN=gatB PE=3 SV=1 2 387 4.0E-58
sp|A9KJ27|GATB_CLOPH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=gatB PE=3 SV=1 1 281 4.0E-58
sp|Q1WSI0|GATB_LACS1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactobacillus salivarius (strain UCC118) GN=gatB PE=3 SV=1 2 456 5.0E-58
sp|A4IJZ3|GATB_GEOTN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacillus thermodenitrificans (strain NG80-2) GN=gatB PE=3 SV=1 2 387 5.0E-58
sp|A7Z268|GATB_BACMF Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=gatB PE=3 SV=1 2 387 5.0E-58
sp|Q6C6I6|GATB_YARLI Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PET112 PE=3 SV=1 1 479 5.0E-58
sp|P33893|GATB_YEAST Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET112 PE=1 SV=3 1 393 6.0E-58
sp|B1HTX0|GATB_LYSSC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lysinibacillus sphaericus (strain C3-41) GN=gatB PE=3 SV=1 2 285 6.0E-58
sp|A9VRH8|GATB_BACWK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus weihenstephanensis (strain KBAB4) GN=gatB PE=3 SV=1 2 387 6.0E-58
sp|Q0VS73|GATB_ALCBS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=gatB PE=3 SV=1 1 387 6.0E-58
sp|B5ED20|GATB_GEOBB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=gatB PE=3 SV=1 1 472 6.0E-58
sp|Q39ZK2|GATB_GEOMG Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=gatB PE=3 SV=1 1 478 7.0E-58
sp|A5N2W5|GATB_CLOK5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=gatB PE=3 SV=1 1 353 7.0E-58
sp|B9DWL7|GATB_CLOK1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium kluyveri (strain NBRC 12016) GN=gatB PE=3 SV=1 1 353 7.0E-58
sp|B6JYB6|GATB_SCHJY Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_01577 PE=3 SV=1 1 456 8.0E-58
sp|B4S5P3|GATB_PROA2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=gatB PE=3 SV=1 1 387 9.0E-58
sp|A6ZKM2|GATB_YEAS7 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=PET112 PE=3 SV=1 1 390 1.0E-57
sp|A7GKK4|GATB_BACCN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=gatB PE=3 SV=1 2 387 1.0E-57
sp|A6VWM9|GATB_MARMS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Marinomonas sp. (strain MWYL1) GN=gatB PE=3 SV=1 1 478 1.0E-57
sp|Q1GIT2|GATB_RUEST Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ruegeria sp. (strain TM1040) GN=gatB PE=3 SV=1 1 387 1.0E-57
sp|Q2R2Z0|GATB_ORYSJ Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=GATB PE=2 SV=1 2 456 1.0E-57
sp|Q7VEG1|GATB_PROMA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gatB PE=3 SV=1 1 478 2.0E-57
sp|Q1GYD4|GATB_METFK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=gatB PE=3 SV=1 1 478 2.0E-57
sp|A1K1T3|GATB_AZOSB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Azoarcus sp. (strain BH72) GN=gatB PE=3 SV=1 1 478 2.0E-57
sp|Q2S1B9|GATB_SALRD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Salinibacter ruber (strain DSM 13855 / M31) GN=gatB PE=3 SV=1 2 387 2.0E-57
sp|A2ZF53|GATB_ORYSI Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial OS=Oryza sativa subsp. indica GN=GATB PE=3 SV=1 2 456 4.0E-57
sp|A1VCY2|GATB_DESVV Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=gatB PE=3 SV=1 1 305 5.0E-57
sp|Q72AV5|GATB_DESVH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=gatB PE=3 SV=1 1 305 5.0E-57
sp|Q93LE1|GATB_GEOSE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacillus stearothermophilus GN=gatB PE=3 SV=1 2 387 6.0E-57
sp|Q5L3B2|GATB_GEOKA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacillus kaustophilus (strain HTA426) GN=gatB PE=3 SV=1 2 387 7.0E-57
sp|A8FAS1|GATB_BACP2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus pumilus (strain SAFR-032) GN=gatB PE=3 SV=1 2 284 9.0E-57
sp|Q146Y4|GATB_BURXL Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia xenovorans (strain LB400) GN=gatB PE=3 SV=1 1 476 9.0E-57
sp|O30509|GATB_BACSU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus subtilis (strain 168) GN=gatB PE=1 SV=2 2 387 9.0E-57
sp|B1XKN8|GATB_SYNP2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=gatB PE=3 SV=1 2 478 1.0E-56
sp|Q10XY9|GATB_TRIEI Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Trichodesmium erythraeum (strain IMS101) GN=gatB PE=3 SV=1 1 478 1.0E-56
sp|B6IZ24|GATB_COXB2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Coxiella burnetii (strain CbuG_Q212) GN=gatB PE=3 SV=1 1 456 1.0E-56
sp|O75879|GATB_HUMAN Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Homo sapiens GN=GATB PE=1 SV=1 1 302 1.0E-56
sp|Q3Z6A1|GATB_DEHM1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=gatB PE=3 SV=1 1 477 1.0E-56
sp|Q83BM8|GATB_COXBU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=gatB PE=3 SV=1 1 456 2.0E-56
sp|Q6AQD0|GATB_DESPS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=gatB PE=3 SV=2 1 456 2.0E-56
sp|B7K293|GATB_CYAP8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Cyanothece sp. (strain PCC 8801) GN=gatB PE=3 SV=1 2 478 2.0E-56
sp|A9N8Z5|GATB_COXBR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=gatB PE=3 SV=1 1 456 2.0E-56
sp|A9KBI1|GATB_COXBN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Coxiella burnetii (strain Dugway 5J108-111) GN=gatB PE=3 SV=1 1 456 2.0E-56
sp|B6J4H6|GATB_COXB1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Coxiella burnetii (strain CbuK_Q154) GN=gatB PE=3 SV=1 1 456 2.0E-56
sp|A2BU03|GATB_PROM5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prochlorococcus marinus (strain MIT 9515) GN=gatB PE=3 SV=1 1 476 3.0E-56
sp|B2J8F0|GATB_NOSP7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=gatB PE=3 SV=1 1 478 3.0E-56
sp|Q65MP7|GATB_BACLD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=gatB PE=3 SV=1 2 387 3.0E-56
sp|A9TWD9|GATB_PHYPA Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial OS=Physcomitrella patens subsp. patens GN=GATB PE=3 SV=1 1 478 4.0E-56
sp|C4XIR3|GATB_DESMR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=gatB PE=3 SV=1 1 387 4.0E-56
sp|B9E825|GATB_MACCJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Macrococcus caseolyticus (strain JCSC5402) GN=gatB PE=3 SV=1 2 477 4.0E-56
sp|C5CY39|GATB_VARPS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Variovorax paradoxus (strain S110) GN=gatB PE=3 SV=1 1 476 5.0E-56
sp|B2JJW3|GATB_BURP8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=gatB PE=3 SV=1 1 436 5.0E-56
sp|A9I0H0|GATB_BORPD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=gatB PE=3 SV=1 1 478 7.0E-56
sp|Q3J9M1|GATB_NITOC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gatB PE=3 SV=1 1 387 7.0E-56
sp|Q2LXN0|GATB2_SYNAS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B 2 OS=Syntrophus aciditrophicus (strain SB) GN=gatB2 PE=3 SV=1 1 387 7.0E-56
sp|Q5WJ19|GATB_BACSK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus clausii (strain KSM-K16) GN=gatB PE=3 SV=1 2 456 8.0E-56
sp|Q8YX22|GATB_NOSS1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gatB PE=3 SV=1 1 478 8.0E-56
sp|P74215|GATB_SYNY3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gatB PE=3 SV=2 2 456 8.0E-56
sp|Q21FS7|GATB_SACD2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=gatB PE=3 SV=1 1 456 9.0E-56
sp|A0RP16|GATB_CAMFF Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=gatB PE=3 SV=1 1 476 1.0E-55
sp|Q6MDF6|GATB_PARUW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Protochlamydia amoebophila (strain UWE25) GN=gatB PE=3 SV=1 1 479 1.0E-55
sp|B1X4D6|GATB_PAUCH Glutamyl-tRNA(Gln) amidotransferase subunit B, organellar chromatophore OS=Paulinella chromatophora GN=PCC_0364 PE=3 SV=1 1 472 1.0E-55
sp|Q3ZW41|GATB_DEHMC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Dehalococcoides mccartyi (strain CBDB1) GN=gatB PE=3 SV=1 1 477 2.0E-55
sp|Q31DD5|GATB_PROM9 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prochlorococcus marinus (strain MIT 9312) GN=gatB PE=3 SV=1 1 478 2.0E-55
sp|Q3B6H8|GATB_CHLL7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=gatB PE=3 SV=1 1 284 2.0E-55
sp|B1WYK7|GATB_CYAA5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Cyanothece sp. (strain ATCC 51142) GN=gatB PE=3 SV=1 2 387 2.0E-55
sp|A2CDJ8|GATB_PROM3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prochlorococcus marinus (strain MIT 9303) GN=gatB PE=3 SV=1 1 478 2.0E-55
sp|B4SBR1|GATB_PELPB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=gatB PE=3 SV=1 1 355 3.0E-55
sp|C5Y3V8|GATB_SORBI Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial OS=Sorghum bicolor GN=GATB PE=3 SV=1 2 456 3.0E-55
sp|A1WVR6|GATB_HALHL Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gatB PE=3 SV=1 1 478 4.0E-55
sp|Q0AFP3|GATB_NITEC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Nitrosomonas eutropha (strain C91) GN=gatB PE=3 SV=1 1 476 4.0E-55
sp|Q2W6Y7|GATB_MAGSA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=gatB PE=3 SV=1 1 387 4.0E-55
sp|B2KE80|GATB_ELUMP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Elusimicrobium minutum (strain Pei191) GN=gatB PE=3 SV=1 2 286 5.0E-55
sp|D2V9W6|GATB_NAEGR Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Naegleria gruberi GN=NAEGRDRAFT_36099 PE=3 SV=1 1 475 6.0E-55
sp|Q21RH8|GATB_RHOFT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=gatB PE=3 SV=2 1 477 7.0E-55
sp|Q97EX9|GATB2_CLOAB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B 2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gatB2 PE=3 SV=1 1 456 7.0E-55
sp|Q837V2|GATB_ENTFA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=gatB PE=3 SV=1 2 456 8.0E-55
sp|Q2YC90|GATB_NITMU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gatB PE=3 SV=1 1 476 8.0E-55
sp|A0KBH8|GATB_BURCH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia cenocepacia (strain HI2424) GN=gatB PE=3 SV=1 1 436 9.0E-55
sp|B1K0H6|GATB_BURCC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia cenocepacia (strain MC0-3) GN=gatB PE=3 SV=1 1 436 9.0E-55
sp|Q1BSL3|GATB_BURCA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia cenocepacia (strain AU 1054) GN=gatB PE=3 SV=1 1 436 9.0E-55
sp|Q7VSN3|GATB_BORPE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=gatB PE=3 SV=1 1 456 1.0E-54
sp|Q38VD0|GATB_LACSS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=gatB PE=3 SV=1 2 394 2.0E-54
sp|Q55ER8|GATB_DICDI Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0268776 PE=3 SV=1 1 285 2.0E-54
sp|B9SQR9|GATB_RICCO Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial OS=Ricinus communis GN=GATB PE=3 SV=1 1 478 2.0E-54
sp|Q39BW4|GATB_BURL3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=gatB PE=3 SV=1 1 436 2.0E-54
sp|A7H2I0|GATB_CAMJD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=gatB PE=3 SV=1 1 476 2.0E-54
sp|B2U7W0|GATB_RALPJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ralstonia pickettii (strain 12J) GN=gatB PE=3 SV=1 1 476 2.0E-54
sp|Q1MPL6|GATB_LAWIP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=gatB PE=3 SV=1 1 381 3.0E-54
sp|Q5M313|GATB_STRT2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=gatB PE=3 SV=1 1 396 3.0E-54
sp|Q5LYF0|GATB_STRT1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus thermophilus (strain CNRZ 1066) GN=gatB PE=3 SV=1 1 396 3.0E-54
sp|Q03J82|GATB_STRTD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=gatB PE=3 SV=1 1 396 3.0E-54
sp|A6LLK6|GATB_THEM4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=gatB PE=3 SV=1 2 286 3.0E-54
sp|A5ICP3|GATB_LEGPC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Legionella pneumophila (strain Corby) GN=gatB PE=3 SV=1 1 456 3.0E-54
sp|Q5P4D1|GATB_AROAE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Aromatoleum aromaticum (strain EbN1) GN=gatB PE=3 SV=1 1 477 3.0E-54
sp|Q72H75|GATB_THET2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=gatB PE=3 SV=1 1 387 4.0E-54
sp|A8FMQ3|GATB_CAMJ8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=gatB PE=3 SV=1 1 476 4.0E-54
sp|C4ZHC0|GATB_EUBR3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=gatB PE=3 SV=1 2 284 4.0E-54
sp|Q5X4H4|GATB_LEGPA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Legionella pneumophila (strain Paris) GN=gatB PE=3 SV=1 1 456 6.0E-54
sp|B1GZD2|GATB_UNCTG Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=gatB PE=3 SV=1 2 387 7.0E-54
sp|Q5ZUQ6|GATB_LEGPH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gatB PE=3 SV=1 1 456 8.0E-54
sp|B3EA25|GATB_GEOLS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=gatB PE=3 SV=1 1 281 8.0E-54
sp|Q5HTR7|GATB_CAMJR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Campylobacter jejuni (strain RM1221) GN=gatB PE=3 SV=1 1 476 1.0E-53
sp|Q2IH95|GATB_ANADE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=gatB PE=3 SV=1 1 339 1.0E-53
sp|Q9LCX2|GATB_THET8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=gatB PE=1 SV=1 1 387 1.0E-53
sp|B1YPV7|GATB_BURA4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia ambifaria (strain MC40-6) GN=gatB PE=3 SV=1 1 436 1.0E-53
sp|A9B5C4|GATB_HERA2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=gatB PE=3 SV=1 1 478 1.0E-53
sp|C1CPU6|GATB_STRZT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=gatB PE=3 SV=1 1 396 1.0E-53
sp|Q7W3H6|GATB_BORPA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=gatB PE=3 SV=1 1 456 1.0E-53
sp|B7IHR3|GATB_THEAB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermosipho africanus (strain TCF52B) GN=gatB PE=3 SV=1 2 289 1.0E-53
sp|Q0BAV5|GATB_BURCM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=gatB PE=3 SV=1 1 436 1.0E-53
sp|Q5WVV9|GATB_LEGPL Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Legionella pneumophila (strain Lens) GN=gatB PE=3 SV=1 1 456 1.0E-53
sp|Q7WEV0|GATB_BORBR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=gatB PE=3 SV=1 1 456 1.0E-53
sp|Q7TUK1|GATB_PROMM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prochlorococcus marinus (strain MIT 9313) GN=gatB PE=3 SV=1 1 387 2.0E-53
sp|Q8DR11|GATB_STRR6 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=gatB PE=3 SV=1 1 396 2.0E-53
sp|Q04M42|GATB_STRP2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=gatB PE=3 SV=1 1 396 2.0E-53
sp|A1V775|GATB_BURMS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia mallei (strain SAVP1) GN=gatB PE=3 SV=1 1 436 2.0E-53
sp|Q62MR3|GATB_BURMA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia mallei (strain ATCC 23344) GN=gatB PE=3 SV=1 1 436 2.0E-53
sp|A2S8J0|GATB_BURM9 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia mallei (strain NCTC 10229) GN=gatB PE=3 SV=1 1 436 2.0E-53
sp|A3MNR7|GATB_BURM7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia mallei (strain NCTC 10247) GN=gatB PE=3 SV=1 1 436 2.0E-53
sp|C1CCJ9|GATB_STRZJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae (strain JJA) GN=gatB PE=3 SV=1 1 396 2.0E-53
sp|Q97SE7|GATB_STRPN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=gatB PE=1 SV=1 1 396 2.0E-53
sp|B1I9M7|GATB_STRPI Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=gatB PE=3 SV=1 1 396 2.0E-53
sp|C1C5H1|GATB_STRP7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae (strain 70585) GN=gatB PE=3 SV=1 1 396 2.0E-53
sp|A7I1W4|GATB_CAMHC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=gatB PE=3 SV=1 1 476 2.0E-53
sp|A2RHP6|GATB_LACLM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=gatB PE=3 SV=1 1 393 2.0E-53
sp|C1CIT7|GATB_STRZP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae (strain P1031) GN=gatB PE=3 SV=1 1 396 2.0E-53
sp|A4VT84|GATB_STRSY Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus suis (strain 05ZYH33) GN=gatB PE=3 SV=1 1 391 2.0E-53
sp|A4VZG6|GATB_STRS2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus suis (strain 98HAH33) GN=gatB PE=3 SV=1 1 391 2.0E-53
sp|Q71YR4|GATB_LISMF Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Listeria monocytogenes serotype 4b (strain F2365) GN=gatB PE=3 SV=1 1 284 2.0E-53
sp|C1KW53|GATB_LISMC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=gatB PE=3 SV=1 1 284 2.0E-53
sp|C0R214|GATB_BRAHW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=gatB PE=3 SV=1 2 473 2.0E-53
sp|A1W0I1|GATB_CAMJJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=gatB PE=3 SV=1 1 476 2.0E-53
sp|A4S450|GATB_OSTLU Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial OS=Ostreococcus lucimarinus (strain CCE9901) GN=GATB PE=3 SV=1 2 479 3.0E-53
sp|B8ZLK0|GATB_STRPJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=gatB PE=3 SV=1 1 396 3.0E-53
sp|O28164|GATB_ARCFU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=gatB PE=3 SV=2 1 466 3.0E-53
sp|B2ILX7|GATB_STRPS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae (strain CGSP14) GN=gatB PE=3 SV=1 1 396 3.0E-53
sp|A3N4F5|GATB_BURP6 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia pseudomallei (strain 668) GN=gatB PE=3 SV=1 1 436 3.0E-53
sp|Q3JXC0|GATB_BURP1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia pseudomallei (strain 1710b) GN=gatB PE=3 SV=1 1 436 3.0E-53
sp|A3NQ46|GATB_BURP0 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia pseudomallei (strain 1106a) GN=gatB PE=3 SV=1 1 436 3.0E-53
sp|B5E1P6|GATB_STRP4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=gatB PE=3 SV=1 1 396 4.0E-53
sp|Q2T292|GATB_BURTA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=gatB PE=3 SV=1 1 436 4.0E-53
sp|Q8Y6D3|GATB_LISMO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gatB PE=3 SV=1 1 284 5.0E-53
sp|B8DFG9|GATB_LISMH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=gatB PE=3 SV=1 1 284 5.0E-53
sp|Q9VCD0|GATB_DROME Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Drosophila melanogaster GN=CG5463 PE=3 SV=2 1 436 5.0E-53
sp|Q92AQ4|GATB_LISIN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=gatB PE=3 SV=1 1 284 5.0E-53
sp|A2BNH6|GATB_PROMS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prochlorococcus marinus (strain AS9601) GN=gatB PE=3 SV=1 1 387 6.0E-53
sp|Q63YJ8|GATB_BURPS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia pseudomallei (strain K96243) GN=gatB PE=3 SV=1 1 436 6.0E-53
sp|Q9RF06|GATB_STAAU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus GN=gatB PE=1 SV=1 2 284 6.0E-53
sp|Q6GFF8|GATB_STAAR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain MRSA252) GN=gatB PE=3 SV=1 2 284 6.0E-53
sp|Q2KU71|GATB_BORA1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bordetella avium (strain 197N) GN=gatB PE=3 SV=1 1 476 7.0E-53
sp|A0AJK7|GATB_LISW6 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=gatB PE=3 SV=1 1 284 8.0E-53
sp|C1CZY8|GATB_DEIDV Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=gatB PE=3 SV=1 1 387 8.0E-53
sp|Q032T2|GATB_LACLS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=gatB PE=3 SV=1 1 393 9.0E-53
sp|A3CLF9|GATB_STRSV Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus sanguinis (strain SK36) GN=gatB PE=3 SV=1 1 479 9.0E-53
sp|Q2J6U8|GATB_FRASC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Frankia sp. (strain CcI3) GN=gatB PE=3 SV=1 1 284 1.0E-52
sp|Q4L7L3|GATB_STAHJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gatB PE=3 SV=1 2 284 1.0E-52
sp|Q5FLL0|GATB_LACAC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=gatB PE=3 SV=1 1 393 1.0E-52
sp|Q9PN98|GATB_CAMJE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=gatB PE=3 SV=1 1 476 1.0E-52
sp|P64202|GATB_STAAW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain MW2) GN=gatB PE=3 SV=1 2 284 2.0E-52
sp|A8Z2R3|GATB_STAAT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=gatB PE=3 SV=1 2 284 2.0E-52
sp|Q6G834|GATB_STAAS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain MSSA476) GN=gatB PE=3 SV=1 2 284 2.0E-52
sp|P99169|GATB_STAAN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain N315) GN=gatB PE=1 SV=1 2 284 2.0E-52
sp|P64201|GATB_STAAM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gatB PE=1 SV=1 2 284 2.0E-52
sp|A6QIC7|GATB_STAAE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain Newman) GN=gatB PE=3 SV=1 2 284 2.0E-52
sp|Q5HEM3|GATB_STAAC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain COL) GN=gatB PE=3 SV=1 2 284 2.0E-52
sp|A5IU66|GATB_STAA9 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain JH9) GN=gatB PE=3 SV=1 2 284 2.0E-52
sp|Q2FWZ0|GATB_STAA8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain NCTC 8325) GN=gatB PE=3 SV=1 2 284 2.0E-52
sp|Q2FFJ6|GATB_STAA3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain USA300) GN=gatB PE=3 SV=1 2 284 2.0E-52
sp|A6U304|GATB_STAA2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain JH1) GN=gatB PE=3 SV=1 2 284 2.0E-52
sp|A7X426|GATB_STAA1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=gatB PE=3 SV=1 2 284 2.0E-52
sp|A8YTZ7|GATB_LACH4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactobacillus helveticus (strain DPC 4571) GN=gatB PE=3 SV=1 1 456 2.0E-52
sp|B8DKV6|GATB_DESVM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=gatB PE=3 SV=1 1 350 2.0E-52
sp|Q9CJ41|GATB_LACLA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gatB PE=3 SV=2 1 393 2.0E-52
sp|A1ATL4|GATB_PELPD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pelobacter propionicus (strain DSM 2379) GN=gatB PE=3 SV=1 1 478 2.0E-52
sp|A9AC50|GATB_BURM1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=gatB PE=3 SV=1 1 436 3.0E-52
sp|Q9UT77|GATB_SCHPO Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC343.13 PE=3 SV=1 1 456 3.0E-52
sp|Q8CRU4|GATB_STAES Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gatB PE=3 SV=1 2 284 3.0E-52
sp|Q5HN35|GATB_STAEQ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gatB PE=3 SV=1 2 284 3.0E-52
sp|B4E7X7|GATB_BURCJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=gatB PE=3 SV=1 1 436 4.0E-52
sp|Q30QX0|GATB_SULDN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=gatB PE=3 SV=1 1 476 5.0E-52
sp|Q8DSG6|GATB_STRMU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=gatB PE=3 SV=1 1 393 7.0E-52
sp|Q00YU3|GATB_OSTTA Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial OS=Ostreococcus tauri GN=GATB PE=3 SV=1 1 397 9.0E-52
sp|A4JIS9|GATB_BURVG Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=gatB PE=3 SV=1 1 436 1.0E-51
sp|Q3SM40|GATB_THIDA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thiobacillus denitrificans (strain ATCC 25259) GN=gatB PE=3 SV=1 1 477 1.0E-51
sp|D0N761|GATB_PHYIT Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Phytophthora infestans (strain T30-4) GN=PITG_07062 PE=3 SV=1 1 477 1.0E-51
sp|B4UIV0|GATB_ANASK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Anaeromyxobacter sp. (strain K) GN=gatB PE=3 SV=1 1 339 1.0E-51
sp|Q8Y3C6|GATB_RALSO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ralstonia solanacearum (strain GMI1000) GN=gatB PE=3 SV=1 1 286 2.0E-51
sp|A7GYS1|GATB_CAMC5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Campylobacter curvus (strain 525.92) GN=gatB PE=3 SV=1 1 476 2.0E-51
sp|A5CX66|GATB_VESOH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=gatB PE=3 SV=1 1 335 2.0E-51
sp|A4X491|GATB_SALTO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=gatB PE=3 SV=1 1 387 2.0E-51
sp|Q9FV81|GATB_ARATH Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=GATB PE=2 SV=1 1 457 2.0E-51
sp|Q041K6|GATB_LACGA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=gatB PE=3 SV=1 1 387 2.0E-51
sp|P61344|GATB_LACJO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=gatB PE=3 SV=1 1 387 3.0E-51
sp|Q9JTZ3|GATB_NEIMA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gatB PE=3 SV=1 1 476 3.0E-51
sp|A8AVE3|GATB_STRGC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=gatB PE=3 SV=1 1 393 3.0E-51
sp|Q2YU27|GATB_STAAB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=gatB PE=3 SV=1 2 284 3.0E-51
sp|Q04BV6|GATB_LACDB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=gatB PE=3 SV=1 2 456 4.0E-51
sp|Q1GBF3|GATB_LACDA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=gatB PE=3 SV=1 2 456 4.0E-51
sp|A5USB5|GATB_ROSS1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Roseiflexus sp. (strain RS-1) GN=gatB PE=3 SV=1 1 456 8.0E-51
sp|Q5XAC8|GATB_STRP6 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=gatB PE=3 SV=1 1 393 9.0E-51
sp|Q45486|GATB_STASP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus sp. GN=gatB PE=3 SV=1 2 284 9.0E-51
sp|Q8NZM1|GATB_STRP8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=gatB PE=3 SV=1 1 393 1.0E-50
sp|A1U487|GATB_MARHV Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=gatB PE=3 SV=1 1 281 1.0E-50
sp|A6LVB6|GATB_CLOB8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=gatB PE=3 SV=1 1 476 1.0E-50
sp|Q99YC1|GATB_STRP1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M1 GN=gatB PE=3 SV=1 1 393 1.0E-50
sp|Q7UK56|GATB_RHOBA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=gatB PE=3 SV=1 1 473 1.0E-50
sp|Q980Q3|GATB_SULSO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gatB PE=3 SV=2 1 476 1.0E-50
sp|A8M5E7|GATB_SALAI Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Salinispora arenicola (strain CNS-205) GN=gatB PE=3 SV=1 1 286 1.0E-50
sp|Q30Y35|GATB_DESAG Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Desulfovibrio alaskensis (strain G20) GN=gatB PE=3 SV=1 1 281 2.0E-50
sp|B8J0A8|GATB_DESDA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=gatB PE=3 SV=1 1 289 2.0E-50
sp|C1E9T6|GATB1_MICSR Glutamyl-tRNA(Gln) amidotransferase subunit B-1, chloroplastic/mitochondrial OS=Micromonas sp. (strain RCC299 / NOUM17) GN=GATB-1 PE=3 SV=1 2 472 2.0E-50
sp|Q8E3P5|GATB_STRA3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gatB PE=3 SV=1 1 393 3.0E-50
sp|A7NQY6|GATB_ROSCS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=gatB PE=3 SV=1 1 337 3.0E-50
sp|Q055U6|GATB_LEPBL Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=gatB PE=3 SV=1 1 394 4.0E-50
sp|Q8DY26|GATB_STRA5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=gatB PE=3 SV=1 1 393 4.0E-50
sp|Q3JZM2|GATB_STRA1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=gatB PE=3 SV=1 1 393 4.0E-50
sp|Q1JKC8|GATB_STRPC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=gatB PE=3 SV=1 1 393 4.0E-50
sp|Q1JA75|GATB_STRPB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=gatB PE=3 SV=1 1 393 4.0E-50
sp|Q8F9D9|GATB_LEPIN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=gatB PE=3 SV=1 1 394 5.0E-50
sp|B3WD58|GATB_LACCB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactobacillus casei (strain BL23) GN=gatB PE=3 SV=1 1 477 5.0E-50
sp|Q1QDJ5|GATB_PSYCK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Psychrobacter cryohalolentis (strain K5) GN=gatB PE=3 SV=1 1 437 5.0E-50
sp|Q04DD2|GATB_OENOB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=gatB PE=3 SV=1 2 284 5.0E-50
sp|B5XHZ8|GATB_STRPZ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=gatB PE=3 SV=1 1 393 5.0E-50
sp|P0DB27|GATB_STRPQ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=gatB PE=3 SV=1 1 393 5.0E-50
sp|Q1JFC0|GATB_STRPD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=gatB PE=3 SV=1 1 393 5.0E-50
sp|P0DB26|GATB_STRP3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=gatB PE=3 SV=1 1 393 5.0E-50
sp|Q7VI13|GATB_HELHP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=gatB PE=3 SV=1 1 476 6.0E-50
sp|Q9Z578|GATB_STRCO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gatB PE=3 SV=1 1 390 6.0E-50
sp|Q04PH9|GATB_LEPBJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=gatB PE=3 SV=1 1 394 6.0E-50
sp|Q48RQ5|GATB_STRPM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=gatB PE=3 SV=1 1 393 6.0E-50
sp|Q49YU3|GATB_STAS1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gatB PE=3 SV=1 2 284 6.0E-50
sp|A2RCV8|GATB_STRPG Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=gatB PE=3 SV=1 1 393 7.0E-50
sp|Q72VS5|GATB_LEPIC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=gatB PE=3 SV=1 1 394 7.0E-50
sp|A4T0G5|GATB_POLSQ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=gatB PE=3 SV=1 1 476 8.0E-50
sp|Q7M7Y2|GATB_WOLSU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=gatB PE=3 SV=1 1 476 8.0E-50
sp|B9DVG5|GATB_STRU0 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=gatB PE=3 SV=1 1 393 8.0E-50
sp|B4RM87|GATB_NEIG2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gatB PE=3 SV=1 1 476 8.0E-50
sp|Q5F8V0|GATB_NEIG1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gatB PE=3 SV=1 1 476 8.0E-50
sp|B9DMT7|GATB_STACT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus carnosus (strain TM300) GN=gatB PE=3 SV=1 2 284 9.0E-50
sp|Q1J570|GATB_STRPF Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=gatB PE=3 SV=1 1 393 1.0E-49
sp|Q9JYZ7|GATB_NEIMB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Neisseria meningitidis serogroup B (strain MC58) GN=gatB PE=3 SV=1 1 476 1.0E-49
sp|A5EW27|GATB_DICNV Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Dichelobacter nodosus (strain VCS1703A) GN=gatB PE=3 SV=1 2 472 1.0E-49
sp|B8JBQ0|GATB_ANAD2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=gatB PE=3 SV=1 1 284 1.0E-49
sp|B0SNZ7|GATB_LEPBP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=gatB PE=3 SV=1 1 387 1.0E-49
sp|B0SFE8|GATB_LEPBA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=gatB PE=3 SV=1 1 387 1.0E-49
sp|Q9RRD7|GATB_DEIRA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=gatB PE=3 SV=2 1 387 2.0E-49
sp|Q47SC0|GATB_THEFY Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermobifida fusca (strain YX) GN=gatB PE=3 SV=1 1 294 2.0E-49
sp|Q4JAU9|GATB_SULAC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gatB PE=3 SV=1 1 473 2.0E-49
sp|Q2FQM1|GATB_METHJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=gatB PE=3 SV=1 1 473 2.0E-49
sp|A0Q8I1|GATB_FRATN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Francisella tularensis subsp. novicida (strain U112) GN=gatB PE=3 SV=1 1 264 2.0E-49
sp|C0ME96|GATB_STRS7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=gatB PE=3 SV=1 1 391 2.0E-49
sp|Q03AB9|GATB_LACC3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactobacillus casei (strain ATCC 334) GN=gatB PE=3 SV=1 1 477 3.0E-49
[Show less]

GO

GO Term Description Terminal node
GO:0016874 ligase activity Yes
GO:0016884 carbon-nitrogen ligase activity, with glutamine as amido-N-donor Yes
GO:0003674 molecular_function No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1662
MPGSQPLLQKEALLPALRAALALNCDVQRVSRFDRKHYFWWDQPAGYQITQYYEPLAKSGYITLYARDGIAREDG
ESVTVGIKQVQLEQDTAKTLAQPGNIQWLDFNRVGVPLIEIITEPHLRHPRTAAVLVRKVQLLLNAVDACVSGME
TGGLRADVNVSVRRTDDPARKLGTRTEIKNLSTIKAVEDAIIAERDRQIRELEAGGTISGETRGWTVGSTETRRL
RGKEGEVDYRYMPDPDIAPVVVGDDLLEHLGASLAVLPDVELDRLVSELGLTPKDAMSLITLDGGDRVQYFYRVL
DQLDEKIRAEFATSALPDLKSYSTLVGNWIIHELGRLTTYKAGPLASGELAFTPDGECVQVPASELSQLLYHLYR
KQITGKVAKTLLMGICLNDLGDGVLRAIETNDLWFKEISEDEYSALADEVLKGEEKVLEQFVEYDVFPQGKLMYL
VGKLMRLGPTERIDPATAESVLRARVEGLRAPR*
Coding >Hirsu2|1662
ATGCCGGGAAGCCAGCCTCTGCTGCAGAAGGAGGCTCTTCTGCCGGCCCTCCGTGCCGCCCTGGCTCTCAACTGC
GACGTGCAGCGCGTCAGCCGCTTCGACCGCAAGCACTATTTCTGGTGGGATCAACCCGCCGGCTATCAAATCACA
CAGTACTACGAGCCCCTGGCCAAGAGCGGCTACATCACCCTCTATGCGCGAGACGGCATTGCTCGCGAGGATGGC
GAGAGCGTGACCGTCGGCATCAAACAAGTCCAGCTCGAGCAGGACACGGCCAAGACACTGGCCCAGCCCGGCAAC
ATACAATGGCTCGACTTCAATCGCGTCGGTGTGCCTCTCATCGAGATCATCACCGAACCGCACCTTCGCCACCCG
CGCACCGCCGCCGTTCTCGTCCGCAAGGTGCAACTCCTCCTCAACGCAGTCGATGCATGCGTTTCCGGCATGGAG
ACGGGCGGTCTGCGGGCCGATGTCAACGTTTCCGTCCGGCGGACGGACGATCCCGCGAGGAAGCTCGGAACGCGG
ACCGAGATCAAGAACCTGAGCACGATCAAGGCCGTGGAGGACGCCATCATCGCGGAGAGAGACCGCCAGATCCGA
GAACTCGAGGCCGGCGGCACCATCTCCGGCGAAACGCGCGGCTGGACGGTGGGCTCGACGGAGACGCGGCGACTT
CGTGGCAAAGAGGGAGAGGTCGACTACCGCTACATGCCAGACCCCGACATTGCACCCGTCGTGGTCGGGGACGAC
CTACTGGAGCACCTGGGCGCATCACTTGCCGTGCTGCCCGACGTCGAGCTGGACAGACTTGTCTCGGAGCTGGGG
CTTACACCAAAGGATGCCATGTCCCTGATCACGCTGGACGGCGGAGATCGCGTCCAGTACTTTTATCGTGTCTTG
GACCAGCTCGACGAGAAAATCAGGGCCGAATTCGCCACGTCAGCTCTGCCCGACCTGAAGAGCTACTCGACACTG
GTGGGGAACTGGATCATTCACGAGCTCGGCCGGCTCACGACATACAAGGCCGGACCACTGGCCTCGGGGGAGCTG
GCCTTTACGCCTGACGGGGAATGCGTCCAAGTTCCCGCTTCGGAGCTGTCGCAGCTGCTGTATCATCTGTACCGC
AAGCAAATCACCGGCAAAGTTGCCAAGACGCTTCTCATGGGAATATGCCTCAATGACCTCGGGGATGGCGTGCTG
CGGGCGATCGAGACCAATGACCTCTGGTTCAAGGAGATTTCCGAGGACGAGTACTCGGCGTTGGCGGACGAGGTC
CTGAAGGGGGAAGAAAAGGTTCTGGAGCAGTTTGTCGAGTACGACGTCTTCCCTCAGGGGAAGTTGATGTACCTG
GTGGGGAAGCTGATGCGACTGGGACCGACGGAGCGCATCGACCCTGCGACTGCGGAGAGCGTCCTGCGCGCTCGA
GTCGAGGGCCTTCGAGCACCACGATGA
Transcript >Hirsu2|1662
ATGCCGGGAAGCCAGCCTCTGCTGCAGAAGGAGGCTCTTCTGCCGGCCCTCCGTGCCGCCCTGGCTCTCAACTGC
GACGTGCAGCGCGTCAGCCGCTTCGACCGCAAGCACTATTTCTGGTGGGATCAACCCGCCGGCTATCAAATCACA
CAGTACTACGAGCCCCTGGCCAAGAGCGGCTACATCACCCTCTATGCGCGAGACGGCATTGCTCGCGAGGATGGC
GAGAGCGTGACCGTCGGCATCAAACAAGTCCAGCTCGAGCAGGACACGGCCAAGACACTGGCCCAGCCCGGCAAC
ATACAATGGCTCGACTTCAATCGCGTCGGTGTGCCTCTCATCGAGATCATCACCGAACCGCACCTTCGCCACCCG
CGCACCGCCGCCGTTCTCGTCCGCAAGGTGCAACTCCTCCTCAACGCAGTCGATGCATGCGTTTCCGGCATGGAG
ACGGGCGGTCTGCGGGCCGATGTCAACGTTTCCGTCCGGCGGACGGACGATCCCGCGAGGAAGCTCGGAACGCGG
ACCGAGATCAAGAACCTGAGCACGATCAAGGCCGTGGAGGACGCCATCATCGCGGAGAGAGACCGCCAGATCCGA
GAACTCGAGGCCGGCGGCACCATCTCCGGCGAAACGCGCGGCTGGACGGTGGGCTCGACGGAGACGCGGCGACTT
CGTGGCAAAGAGGGAGAGGTCGACTACCGCTACATGCCAGACCCCGACATTGCACCCGTCGTGGTCGGGGACGAC
CTACTGGAGCACCTGGGCGCATCACTTGCCGTGCTGCCCGACGTCGAGCTGGACAGACTTGTCTCGGAGCTGGGG
CTTACACCAAAGGATGCCATGTCCCTGATCACGCTGGACGGCGGAGATCGCGTCCAGTACTTTTATCGTGTCTTG
GACCAGCTCGACGAGAAAATCAGGGCCGAATTCGCCACGTCAGCTCTGCCCGACCTGAAGAGCTACTCGACACTG
GTGGGGAACTGGATCATTCACGAGCTCGGCCGGCTCACGACATACAAGGCCGGACCACTGGCCTCGGGGGAGCTG
GCCTTTACGCCTGACGGGGAATGCGTCCAAGTTCCCGCTTCGGAGCTGTCGCAGCTGCTGTATCATCTGTACCGC
AAGCAAATCACCGGCAAAGTTGCCAAGACGCTTCTCATGGGAATATGCCTCAATGACCTCGGGGATGGCGTGCTG
CGGGCGATCGAGACCAATGACCTCTGGTTCAAGGAGATTTCCGAGGACGAGTACTCGGCGTTGGCGGACGAGGTC
CTGAAGGGGGAAGAAAAGGTTCTGGAGCAGTTTGTCGAGTACGACGTCTTCCCTCAGGGGAAGTTGATGTACCTG
GTGGGGAAGCTGATGCGACTGGGACCGACGGAGCGCATCGACCCTGCGACTGCGGAGAGCGTCCTGCGCGCTCGA
GTCGAGGGCCTTCGAGCACCACGATGA
Gene >Hirsu2|1662
ATGCCGGGAAGCCAGCCTCTGCTGCAGAAGGAGGCTCTTCTGCCGGCCCTCCGTGCCGCCCTGGCTCTCAACTGC
GACGTGCAGCGCGTCAGCCGCTTCGACCGCAAGCACTATTTCTGGTGGGATCAACCCGCCGGCTATCAAATCACA
CAGTACTACGAGCCCCTGGCCAAGAGCGGCTACATCACCCTCTATGCGCGAGACGGCATTGCTCGCGAGGATGGC
GAGAGCGTGACCGTCGGCATCAAACAAGTCCAGCTCGAGCAGGACACGGCCAAGACACTGGCCCAGCCCGGCAAC
ATACAATGGCTCGACTTCAATCGCGTCGGTGTGCCTCTCATCGAGATCATCACCGAACCGCACCTTCGCCACCCG
CGCACCGCCGCCGTTCTCGTCCGCAAGGTGCAACTCCTCCTCAACGCAGTCGATGCATGCGTTTCCGGCATGGAG
ACGGGCGGTCTGCGGGCCGATGTCAACGTTTCCGTCCGGCGGACGGACGATCCCGCGAGGAAGCTCGGAACGCGG
ACCGAGATCAAGAACCTGAGCACGATCAAGGCCGTGGAGGACGCCATCATCGCGGAGAGAGACCGCCAGATCCGA
GAACTCGAGGCCGGCGGCACCATCTCCGGCGAAACGCGCGGCTGGACGGTGGGCTCGACGGAGACGCGGCGACTT
CGTGGCAAAGAGGGAGAGGTCGACTACCGCTACATGCCAGACCCCGACATTGCACCCGTCGTGGTCGGGGACGAC
CTACTGGAGCACCTGGGCGCATCACTTGCCGTGCTGCCCGACGTCGAGCTGGACAGACTTGTCTCGGAGCTGGGG
CTTACACCAAAGGATGCCATGTCCCTGATCACGCTGGACGGCGGAGATCGCGTCCAGTACTTTTATCGTGTCTTG
GACCAGCTCGACGAGAAAATCAGGGCCGAATTCGCCACGTCAGCTCTGCCCGACCTGAAGAGCTACTCGACACTG
GTGGGGAACTGGATCATTCACGAGCTCGGCCGGCTCACGACATACAAGGCCGGACCACTGGCCTCGGGGGAGCTG
GCCTTTACGCCTGACGGGGAATGCGTCCAAGTTCCCGCTTCGGAGCTGTCGCAGCTGCTGTATCATCTGTACCGC
AAGCAAATCACCGGCAAAGTTGCCAAGACGCTTCTCATGGGAATATGCCTCAATGACCTCGGGGATGGCGTGCTG
CGGGCGATCGAGACCAATGACCTCTGGTTCAAGGAGATTTCCGAGGACGAGTACTCGGCGTTGGCGGACGAGGTC
CTGAAGGGGGAAGAAAAGGTTCTGGAGCAGTTTGTCGAGTACGACGTCTTCCCTCAGGGGAAGTTGATGTACCTG
GTGGGGAAGCTGATGCGACTGGGACCGACGGAGCGCATCGACCCTGCGACTGCGGAGAGCGTCCTGCGCGCTCGA
GTCGAGGGCCTTCGAGCACCACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail