Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1645
Gene name
LocationContig_1370:3203..5489
Strand+
Gene length (bp)2286
Transcript length (bp)2121
Coding sequence length (bp)2121
Protein length (aa) 707

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 1.3E-20 185 418
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 3.6E-17 285 470
PF00535 Glycos_transf_2 Glycosyl transferase family 2 8.2E-17 187 365
PF03552 Cellulose_synt Cellulose synthase 7.9E-11 355 497
PF13506 Glyco_transf_21 Glycosyl transferase family 21 2.1E-13 260 417

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9WX75|BCSA5_KOMXY Putative cellulose synthase 3 OS=Komagataeibacter xylinus GN=bcsABII-B PE=3 SV=1 184 473 3.0E-31
sp|Q9RBJ2|BCSA4_KOMXY Putative cellulose synthase 2 OS=Komagataeibacter xylinus GN=bcsABII-A PE=3 SV=1 184 473 3.0E-31
sp|O82859|BCSA2_KOMXY Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus GN=bcsA PE=3 SV=1 182 478 2.0E-30
sp|P58931|BCSA_PSEFS Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) GN=bcsA PE=3 SV=2 119 480 6.0E-30
sp|P0CW87|ACSA1_KOMXY Cellulose synthase 1 OS=Komagataeibacter xylinus GN=acsAB PE=1 SV=1 184 481 7.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9WX75|BCSA5_KOMXY Putative cellulose synthase 3 OS=Komagataeibacter xylinus GN=bcsABII-B PE=3 SV=1 184 473 3.0E-31
sp|Q9RBJ2|BCSA4_KOMXY Putative cellulose synthase 2 OS=Komagataeibacter xylinus GN=bcsABII-A PE=3 SV=1 184 473 3.0E-31
sp|O82859|BCSA2_KOMXY Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus GN=bcsA PE=3 SV=1 182 478 2.0E-30
sp|P58931|BCSA_PSEFS Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) GN=bcsA PE=3 SV=2 119 480 6.0E-30
sp|P0CW87|ACSA1_KOMXY Cellulose synthase 1 OS=Komagataeibacter xylinus GN=acsAB PE=1 SV=1 184 481 7.0E-30
sp|Q76KJ8|ACSA1_KOMHA Cellulose synthase 1 OS=Komagataeibacter hansenii GN=acsAB PE=1 SV=1 184 481 9.0E-30
sp|P19449|BCSA1_KOMXY Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus GN=bcsA PE=1 SV=1 182 540 1.0E-29
sp|Q59167|ACSA2_KOMHA Cellulose synthase 2 OS=Komagataeibacter hansenii GN=acsAII PE=3 SV=1 182 451 2.0E-29
sp|Q9WX61|BCSA3_KOMXY Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus GN=bcsAI PE=3 SV=1 184 540 5.0E-29
sp|Q8Z291|BCSA_SALTI Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi GN=bcsA PE=3 SV=1 184 468 7.0E-28
sp|Q93IN2|BCSA_SALTY Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=bcsA PE=3 SV=1 184 468 1.0E-27
sp|P58932|BCSA_XANAC Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) GN=bcsA PE=3 SV=1 184 481 7.0E-27
sp|P37653|BCSA_ECOLI Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) GN=bcsA PE=1 SV=3 184 445 3.0E-26
sp|Q8X5L7|BCSA_ECO57 Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 GN=bcsA PE=3 SV=2 184 445 4.0E-26
sp|Q9U720|DCSA_DICDI Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum GN=dcsA PE=1 SV=1 242 422 9.0E-19
sp|Q9SB75|CSLC5_ARATH Probable xyloglucan glycosyltransferase 5 OS=Arabidopsis thaliana GN=CSLC5 PE=1 SV=1 180 419 4.0E-16
sp|Q7PC70|CSLC2_ORYSI Probable xyloglucan glycosyltransferase 2 OS=Oryza sativa subsp. indica GN=CSLC2 PE=2 SV=1 180 419 5.0E-16
sp|Q69L19|CSLC2_ORYSJ Probable xyloglucan glycosyltransferase 2 OS=Oryza sativa subsp. japonica GN=CSLC2 PE=2 SV=2 180 419 6.0E-16
sp|Q9SJA2|CSLC8_ARATH Probable xyloglucan glycosyltransferase 8 OS=Arabidopsis thaliana GN=CSLC8 PE=2 SV=1 180 466 1.0E-15
sp|Q6UDF0|CSLA1_CYATE Mannan synthase 1 OS=Cyamopsis tetragonoloba GN=ManS PE=1 SV=1 126 427 2.0E-15
sp|Q9LZR3|CSLA9_ARATH Glucomannan 4-beta-mannosyltransferase 9 OS=Arabidopsis thaliana GN=CSLA9 PE=2 SV=1 203 435 3.0E-15
sp|Q6YWK8|CSLAB_ORYSJ Probable mannan synthase 11 OS=Oryza sativa subsp. japonica GN=CSLA11 PE=2 SV=1 203 469 9.0E-15
sp|Q6Z2T9|CSLA6_ORYSJ Probable mannan synthase 6 OS=Oryza sativa subsp. japonica GN=CSLA6 PE=2 SV=2 184 419 9.0E-14
sp|Q7XIF5|CSLA7_ORYSJ Probable mannan synthase 7 OS=Oryza sativa subsp. japonica GN=CSLA7 PE=2 SV=1 203 422 1.0E-13
sp|Q9SRT3|CSLC6_ARATH Probable xyloglucan glycosyltransferase 6 OS=Arabidopsis thaliana GN=CSLC6 PE=1 SV=1 178 429 1.0E-13
sp|Q9FNI7|CSLA2_ARATH Glucomannan 4-beta-mannosyltransferase 2 OS=Arabidopsis thaliana GN=CSLA2 PE=2 SV=1 182 427 2.0E-13
sp|Q8S7W0|CSLA4_ORYSJ Probable mannan synthase 4 OS=Oryza sativa subsp. japonica GN=CSLA4 PE=2 SV=1 184 427 2.0E-13
sp|Q7PC67|CSLA2_ORYSJ Probable mannan synthase 2 OS=Oryza sativa subsp. japonica GN=CSLA2 PE=2 SV=2 195 427 2.0E-13
sp|Q9T0L2|CSLAF_ARATH Probable mannan synthase 15 OS=Arabidopsis thaliana GN=CSLA15 PE=3 SV=2 173 419 4.0E-13
sp|Q67X45|CSLA3_ORYSJ Probable mannan synthase 3 OS=Oryza sativa subsp. japonica GN=CSLA3 PE=2 SV=1 195 422 4.0E-13
sp|Q7PC69|CSLC3_ORYSJ Probable xyloglucan glycosyltransferase 3 OS=Oryza sativa subsp. japonica GN=CSLC3 PE=2 SV=1 180 465 5.0E-13
sp|Q7PC76|CSLA1_ORYSJ Glucomannan 4-beta-mannosyltransferase 1 OS=Oryza sativa subsp. japonica GN=CSLA1 PE=3 SV=1 195 427 8.0E-13
sp|Q9LJP4|CSLC4_ARATH Xyloglucan glycosyltransferase 4 OS=Arabidopsis thaliana GN=CSLC4 PE=1 SV=1 166 419 1.0E-12
sp|Q6AU53|CSLC9_ORYSJ Probable xyloglucan glycosyltransferase 9 OS=Oryza sativa subsp. japonica GN=CSLC9 PE=2 SV=2 184 419 3.0E-12
sp|Q8LIY0|CSLC1_ORYSJ Probable xyloglucan glycosyltransferase 1 OS=Oryza sativa subsp. japonica GN=CSLC1 PE=3 SV=1 182 429 4.0E-12
sp|Q8NUI7|ICAA_STAAW Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MW2) GN=icaA PE=3 SV=1 156 419 1.0E-11
sp|Q6G608|ICAA_STAAS Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MSSA476) GN=icaA PE=3 SV=1 156 419 1.0E-11
sp|Q7PC73|CSLA5_ORYSJ Probable mannan synthase 5 OS=Oryza sativa subsp. japonica GN=CSLA5 PE=2 SV=1 203 427 2.0E-11
sp|Q9LQC9|CSLA3_ARATH Probable mannan synthase 3 OS=Arabidopsis thaliana GN=CSLA3 PE=2 SV=1 79 419 2.0E-11
sp|Q6GDD8|ICAA_STAAR Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) GN=icaA PE=3 SV=1 156 419 3.0E-11
sp|Q7A351|ICAA_STAAN Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) GN=icaA PE=3 SV=1 156 419 3.0E-11
sp|Q99QX3|ICAA_STAAM Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=icaA PE=3 SV=1 156 419 3.0E-11
sp|Q5HCN1|ICAA_STAAC Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) GN=icaA PE=3 SV=1 156 419 3.0E-11
sp|Q9RQP9|ICAA_STAA8 Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=icaA PE=3 SV=2 156 419 3.0E-11
sp|Q9LF09|CSLAB_ARATH Probable mannan synthase 11 OS=Arabidopsis thaliana GN=CSLA11 PE=2 SV=2 173 419 3.0E-11
sp|Q6L538|CSLC7_ORYSJ Probable xyloglucan glycosyltransferase 7 OS=Oryza sativa subsp. japonica GN=CSLC7 PE=2 SV=1 182 429 5.0E-11
sp|Q84W54|CSLA1_ARATH Probable mannan synthase 1 OS=Arabidopsis thaliana GN=CSLA1 PE=2 SV=1 182 465 7.0E-11
sp|Q9ZQB9|CSLCC_ARATH Probable xyloglucan glycosyltransferase 12 OS=Arabidopsis thaliana GN=CSLC12 PE=1 SV=1 179 419 7.0E-11
sp|Q67VS7|CSLA9_ORYSJ Probable mannan synthase 9 OS=Oryza sativa subsp. japonica GN=CSLA9 PE=2 SV=1 203 427 9.0E-11
sp|Q9ZQN8|CSLA7_ARATH Probable mannan synthase 7 OS=Arabidopsis thaliana GN=CSLA7 PE=2 SV=2 195 419 1.0E-10
sp|Q84W06|CSLAE_ARATH Probable mannan synthase 14 OS=Arabidopsis thaliana GN=CSLA14 PE=2 SV=2 196 419 2.0E-10
sp|P75905|PGAC_ECOLI Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) GN=pgaC PE=1 SV=1 182 469 2.0E-10
sp|Q8GLC5|ICAA_STAEP Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis GN=icaA PE=3 SV=1 189 419 3.0E-10
sp|Q8XAR5|PGAC_ECO57 Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 GN=pgaC PE=3 SV=1 182 469 3.0E-10
sp|Q84Z01|CSLCA_ORYSJ Putative xyloglucan glycosyltransferase 10 OS=Oryza sativa subsp. japonica GN=CSLC10 PE=3 SV=1 184 419 5.0E-10
sp|A2YHR9|CSLCA_ORYSI Putative xyloglucan glycosyltransferase 10 OS=Oryza sativa subsp. indica GN=CSLC10 PE=3 SV=1 184 419 5.0E-10
sp|Q5HKQ0|ICAA_STAEQ Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=icaA PE=1 SV=1 189 419 5.0E-10
sp|Q9LR87|CSLAA_ARATH Probable mannan synthase 10 OS=Arabidopsis thaliana GN=CSLA10 PE=2 SV=2 173 419 4.0E-09
sp|P96587|YDAM_BACSU Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) GN=ydaM PE=3 SV=1 170 420 7.0E-09
sp|P74165|BMGDS_SYNY3 Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1377 PE=1 SV=1 189 419 3.0E-07
sp|O49323|CSLD1_ARATH Cellulose synthase-like protein D1 OS=Arabidopsis thaliana GN=CSLD1 PE=2 SV=1 371 499 7.0E-07
sp|Q84ZN6|CESA8_ORYSJ Probable cellulose synthase A catalytic subunit 8 [UDP-forming] OS=Oryza sativa subsp. japonica GN=CESA8 PE=2 SV=1 341 492 9.0E-07
sp|Q84M43|CESA2_ORYSJ Probable cellulose synthase A catalytic subunit 2 [UDP-forming] OS=Oryza sativa subsp. japonica GN=CESA2 PE=2 SV=1 341 492 2.0E-06
sp|A2XN66|CESA2_ORYSI Probable cellulose synthase A catalytic subunit 2 [UDP-forming] OS=Oryza sativa subsp. indica GN=CESA2 PE=3 SV=1 341 492 2.0E-06
sp|Q84JA6|CESA4_ARATH Cellulose synthase A catalytic subunit 4 [UDP-forming] OS=Arabidopsis thaliana GN=CESA4 PE=1 SV=1 341 505 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0016760 cellulose synthase (UDP-forming) activity Yes
GO:0030244 cellulose biosynthetic process Yes
GO:0016757 transferase activity, transferring glycosyl groups Yes
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0005976 polysaccharide metabolic process No
GO:0034637 cellular carbohydrate biosynthetic process No
GO:0051273 beta-glucan metabolic process No
GO:0044042 glucan metabolic process No
GO:0035251 UDP-glucosyltransferase activity No
GO:0051274 beta-glucan biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0046527 glucosyltransferase activity No
GO:0030243 cellulose metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0044262 cellular carbohydrate metabolic process No
GO:0016759 cellulose synthase activity No
GO:0009250 glucan biosynthetic process No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0016051 carbohydrate biosynthetic process No
GO:0044264 cellular polysaccharide metabolic process No
GO:0016758 transferase activity, transferring hexosyl groups No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0006073 cellular glucan metabolic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0000271 polysaccharide biosynthetic process No
GO:0033692 cellular polysaccharide biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 102 124 22
2 139 161 22
3 445 467 22
4 524 546 22
5 579 601 22
6 624 646 22
7 682 704 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1645
MAARSDAQTLVDSPNASRASLRSFQTGQQTPADSSASTKFSPFADSGPSTPMNQSNISLAALLQNAASQQSGKNS
PEHDATDSISVLHSRDDADIWHGWRRHLFRLVPFMTFANTGIYLAYLVLRILCVLSAQKYHQEIYAAAWVFIAVE
IAVAIPSLLHNSWTMWSMKKRARQKLRLRGYDVPTVDVFITCCGEEDDLVLDTVRAACDLDYPYDRFRVVVLDDG
KSTGLEAAVARLAFNYPNVCYMAREKIPGKPHHFKAGNLNYGLEQVHRLPGGAGQFMAALDADMIPERDWLRAVL
PHLLADPKMALACPPQLFYNTPSCDPLAQSLDFFVHVIEPIKDTLGVAWCTGSGYVVRREALDDIGNFPLGSLAE
DVATSTLMLGKGWKTAYVHEPLQFGTVPEDYGSHLKQRTRWAIGTVDTSFKLNFCLWGEKVRQMTFAQRFSGFLY
ATLSLYTILLTISLFAIPIILVSGKSLVAYADDDQLRWLIRLCFAATISNRLCEFVLSIPAGYHTGQRSARYQLW
MSPYIALCIIRSFILPTWLGGTTQAFKPTGSLSSALNERDPVRKKNMVRRLWAILVNYMGVFHLAFVYLTLVGVV
LTSFRCFVLQKSTKDLLLGLVTHAFWPPLTFIFICSSLWVPIAYAIDPPMMPDREELLERDPKTMVAHPTAKSKK
IAFGGQAAWFELELTTTTLYTAFIFVLSFVF*
Coding >Hirsu2|1645
ATGGCGGCCAGGTCCGACGCCCAGACTCTGGTCGACAGCCCCAACGCCTCCCGCGCCAGCCTTCGCTCCTTTCAG
ACTGGACAGCAGACGCCCGCCGACTCGTCGGCCTCGACCAAGTTCTCCCCCTTTGCCGATTCCGGCCCTTCCACG
CCCATGAATCAAAGCAACATCAGTCTCGCCGCCCTCCTCCAGAATGCCGCCTCGCAACAGAGCGGCAAGAACTCG
CCTGAACACGACGCTACCGACTCCATTTCTGTCCTGCACAGCCGCGACGATGCCGATATCTGGCATGGCTGGAGG
CGCCACCTCTTTCGACTCGTGCCGTTCATGACCTTTGCCAACACGGGCATCTACCTGGCTTACCTCGTCCTGCGC
ATCTTGTGCGTCCTCTCGGCACAGAAGTATCACCAGGAAATCTATGCCGCCGCCTGGGTCTTCATCGCCGTCGAG
ATTGCTGTTGCCATTCCGTCGCTCCTGCACAACTCATGGACCATGTGGTCCATGAAGAAGCGCGCCCGCCAAAAG
CTGCGCCTTCGCGGCTACGATGTCCCCACTGTTGATGTCTTCATCACCTGCTGCGGCGAGGAGGACGATCTTGTC
CTCGACACCGTCCGGGCCGCCTGCGACCTCGACTACCCATACGACCGCTTCCGCGTCGTCGTCCTCGACGACGGC
AAGTCGACTGGCCTTGAGGCCGCTGTCGCCCGCCTGGCCTTCAACTACCCCAACGTCTGCTACATGGCTCGCGAG
AAGATTCCTGGCAAGCCCCATCACTTCAAGGCTGGCAACCTCAACTATGGCCTCGAGCAGGTCCACCGCCTGCCC
GGCGGCGCCGGCCAGTTCATGGCTGCCTTGGACGCCGACATGATTCCCGAGCGAGACTGGCTCCGCGCCGTGCTT
CCTCACTTGTTGGCCGATCCCAAGATGGCCCTCGCCTGCCCGCCGCAGTTGTTCTACAACACCCCGTCCTGCGAC
CCACTCGCCCAGAGCCTCGACTTTTTCGTCCATGTCATCGAGCCCATCAAGGACACGCTCGGCGTGGCCTGGTGT
ACCGGGTCCGGATACGTTGTCCGCCGCGAAGCCCTCGACGACATTGGCAACTTCCCCCTGGGCTCGCTCGCCGAG
GACGTGGCGACCTCGACGCTTATGCTGGGCAAGGGTTGGAAGACGGCCTACGTCCACGAGCCCCTGCAGTTCGGC
ACGGTCCCCGAGGACTACGGTAGCCATCTGAAGCAGCGGACGCGCTGGGCCATCGGCACCGTCGACACGTCCTTC
AAGCTCAACTTTTGCCTGTGGGGAGAAAAGGTCCGGCAGATGACGTTCGCCCAGCGCTTCTCCGGCTTCCTCTAC
GCGACGCTCAGCCTGTACACGATCCTGCTCACCATTTCGCTCTTCGCCATTCCCATCATCCTCGTCTCGGGCAAG
TCGCTGGTTGCCTACGCCGACGACGACCAGCTGCGTTGGCTCATCCGCCTGTGCTTCGCCGCGACCATCAGCAAC
CGGCTCTGCGAGTTCGTCTTGTCCATCCCCGCCGGCTACCACACCGGGCAGCGCAGCGCCCGCTACCAGCTGTGG
ATGTCTCCCTACATCGCCCTGTGCATCATCCGCTCCTTCATCCTGCCCACCTGGCTCGGCGGCACGACGCAGGCC
TTCAAGCCGACGGGCTCCCTCTCCTCGGCCCTCAACGAGCGCGACCCGGTCAGGAAGAAGAACATGGTCCGCCGG
CTCTGGGCCATCCTGGTCAACTACATGGGTGTCTTCCACCTGGCCTTTGTCTACCTGACGCTGGTTGGCGTTGTC
CTGACGTCGTTCCGCTGCTTCGTGCTGCAGAAGAGCACCAAGGACCTGCTGCTCGGCCTTGTGACGCACGCCTTC
TGGCCACCCTTGACGTTCATCTTCATCTGCAGCTCCCTCTGGGTCCCGATTGCGTACGCCATCGACCCCCCGATG
ATGCCGGATCGCGAGGAGCTGCTGGAGCGCGACCCAAAGACGATGGTCGCCCACCCCACGGCTAAGAGCAAGAAG
ATTGCGTTCGGCGGCCAGGCGGCCTGGTTCGAGCTCGAGCTCACCACGACGACTCTCTACACCGCATTCATTTTC
GTTTTATCATTCGTCTTCTGA
Transcript >Hirsu2|1645
ATGGCGGCCAGGTCCGACGCCCAGACTCTGGTCGACAGCCCCAACGCCTCCCGCGCCAGCCTTCGCTCCTTTCAG
ACTGGACAGCAGACGCCCGCCGACTCGTCGGCCTCGACCAAGTTCTCCCCCTTTGCCGATTCCGGCCCTTCCACG
CCCATGAATCAAAGCAACATCAGTCTCGCCGCCCTCCTCCAGAATGCCGCCTCGCAACAGAGCGGCAAGAACTCG
CCTGAACACGACGCTACCGACTCCATTTCTGTCCTGCACAGCCGCGACGATGCCGATATCTGGCATGGCTGGAGG
CGCCACCTCTTTCGACTCGTGCCGTTCATGACCTTTGCCAACACGGGCATCTACCTGGCTTACCTCGTCCTGCGC
ATCTTGTGCGTCCTCTCGGCACAGAAGTATCACCAGGAAATCTATGCCGCCGCCTGGGTCTTCATCGCCGTCGAG
ATTGCTGTTGCCATTCCGTCGCTCCTGCACAACTCATGGACCATGTGGTCCATGAAGAAGCGCGCCCGCCAAAAG
CTGCGCCTTCGCGGCTACGATGTCCCCACTGTTGATGTCTTCATCACCTGCTGCGGCGAGGAGGACGATCTTGTC
CTCGACACCGTCCGGGCCGCCTGCGACCTCGACTACCCATACGACCGCTTCCGCGTCGTCGTCCTCGACGACGGC
AAGTCGACTGGCCTTGAGGCCGCTGTCGCCCGCCTGGCCTTCAACTACCCCAACGTCTGCTACATGGCTCGCGAG
AAGATTCCTGGCAAGCCCCATCACTTCAAGGCTGGCAACCTCAACTATGGCCTCGAGCAGGTCCACCGCCTGCCC
GGCGGCGCCGGCCAGTTCATGGCTGCCTTGGACGCCGACATGATTCCCGAGCGAGACTGGCTCCGCGCCGTGCTT
CCTCACTTGTTGGCCGATCCCAAGATGGCCCTCGCCTGCCCGCCGCAGTTGTTCTACAACACCCCGTCCTGCGAC
CCACTCGCCCAGAGCCTCGACTTTTTCGTCCATGTCATCGAGCCCATCAAGGACACGCTCGGCGTGGCCTGGTGT
ACCGGGTCCGGATACGTTGTCCGCCGCGAAGCCCTCGACGACATTGGCAACTTCCCCCTGGGCTCGCTCGCCGAG
GACGTGGCGACCTCGACGCTTATGCTGGGCAAGGGTTGGAAGACGGCCTACGTCCACGAGCCCCTGCAGTTCGGC
ACGGTCCCCGAGGACTACGGTAGCCATCTGAAGCAGCGGACGCGCTGGGCCATCGGCACCGTCGACACGTCCTTC
AAGCTCAACTTTTGCCTGTGGGGAGAAAAGGTCCGGCAGATGACGTTCGCCCAGCGCTTCTCCGGCTTCCTCTAC
GCGACGCTCAGCCTGTACACGATCCTGCTCACCATTTCGCTCTTCGCCATTCCCATCATCCTCGTCTCGGGCAAG
TCGCTGGTTGCCTACGCCGACGACGACCAGCTGCGTTGGCTCATCCGCCTGTGCTTCGCCGCGACCATCAGCAAC
CGGCTCTGCGAGTTCGTCTTGTCCATCCCCGCCGGCTACCACACCGGGCAGCGCAGCGCCCGCTACCAGCTGTGG
ATGTCTCCCTACATCGCCCTGTGCATCATCCGCTCCTTCATCCTGCCCACCTGGCTCGGCGGCACGACGCAGGCC
TTCAAGCCGACGGGCTCCCTCTCCTCGGCCCTCAACGAGCGCGACCCGGTCAGGAAGAAGAACATGGTCCGCCGG
CTCTGGGCCATCCTGGTCAACTACATGGGTGTCTTCCACCTGGCCTTTGTCTACCTGACGCTGGTTGGCGTTGTC
CTGACGTCGTTCCGCTGCTTCGTGCTGCAGAAGAGCACCAAGGACCTGCTGCTCGGCCTTGTGACGCACGCCTTC
TGGCCACCCTTGACGTTCATCTTCATCTGCAGCTCCCTCTGGGTCCCGATTGCGTACGCCATCGACCCCCCGATG
ATGCCGGATCGCGAGGAGCTGCTGGAGCGCGACCCAAAGACGATGGTCGCCCACCCCACGGCTAAGAGCAAGAAG
ATTGCGTTCGGCGGCCAGGCGGCCTGGTTCGAGCTCGAGCTCACCACGACGACTCTCTACACCGCATTCATTTTC
GTTTTATCATTCGTCTTCTGA
Gene >Hirsu2|1645
ATGGCGGCCAGGTCCGACGCCCAGACTCTGGTCGACAGCCCCAACGCCTCCCGCGCCAGCCTTCGCTCCTTTCAG
ACTGGACAGCAGACGCCCGCCGACTCGTCGGCCTCGACCAAGTTCTCCCCCTTTGCCGATTCCGGCCCTTCCACG
CCCATGGTGAGCGCGGCCCCCGGCTGGCCCTCCTTGGCTCGAGCCCGTGCCCGAGCCCTCGGCCGTGCCGCCTCG
TCGCTAACCCGTTCGCCTGTAGAATCAAAGCAACATCAGTCTCGCCGCCCTCCTCCAGAATGCCGCCTCGCAACA
GAGCGGCAAGAACTCGCCTGAACACGACGCTACCGACTCCATTTCTGTCCTGCACAGCCGCGACGATGCCGATAT
CTGGCATGGCTGGAGGCGCCACCTCTTTCGACTCGTGCCGTTCATGACCTTTGCCAACACGGGCATCTACCTGGC
TTACCTCGTCCTGCGCATCTTGTGCGTCCTCTCGGCACAGAAGTATCACCAGGAAATCTATGCCGCCGCCTGGGT
CTTCATCGCCGTCGAGATTGCTGTTGCCATTCCGTCGCTCCTGCACAACTCATGGACCATGTGGTCCATGAAGAA
GCGCGCCCGCCAAAAGCTGCGCCTTCGCGGCTACGATGTCCCCACTGTTGATGTCTTCATCACCTGCTGCGGCGA
GGAGGACGATCTTGTCCTCGACACCGTCCGGGCCGCCTGCGACCTCGACTACCCATACGACCGCTTCCGCGTCGT
CGTCCTCGACGACGGCAAGTCGACTGGCCTTGAGGCCGCTGTCGCCCGCCTGGCCTTCAACTACCCCAACGTCTG
CTACATGGCTCGCGAGAAGATTCCTGGCAAGCCCCATCACTTCAAGGCTGGCAACCTCAACTATGGCCTCGAGCA
GGTCCACCGCCTGCCCGGCGGCGCCGGCCAGTTCATGGCTGCCTTGGACGCCGACATGGTAAGGCCCCCCTCCCT
AGCACTTGCCCCTCCCCTCTTAACCCTCGGCCTCTTCTGACGACTGGACTCCAACAGATTCCCGAGCGAGACTGG
CTCCGCGCCGTGCTTCCTCACTTGTTGGCCGATCCCAAGATGGCCCTCGCCTGCCCGCCGCAGTTGTTCTACAAC
ACCCCGTCCTGCGACCCACTCGCCCAGAGCCTCGACTTTTTCGTCCATGTCATCGAGCCCATCAAGGACACGCTC
GGCGTGGCCTGGTGTACCGGGTCCGGATACGTTGTCCGCCGCGAAGCCCTCGACGACATTGGCAACTTCCCCCTG
GGCTCGCTCGCCGAGGACGTGGCGACCTCGACGCTTATGCTGGGCAAGGGTTGGAAGACGGCCTACGTCCACGAG
CCCCTGCAGTTCGGCACGGTCCCCGAGGACTACGGTAGCCATCTGAAGCAGCGGACGCGCTGGGCCATCGGCACC
GTCGACACGTCCTTCAAGCTCAACTTTTGCCTGTGGGGAGAAAAGGTCCGGCAGATGACGTTCGCCCAGCGCTTC
TCCGGCTTCCTCTACGCGACGCTCAGCCTGTACACGATCCTGCTCACCATTTCGCTCTTCGCCATTCCCATCATC
CTCGTCTCGGGCAAGTCGCTGGTTGCCTACGCCGACGACGACCAGCTGCGTTGGCTCATCCGCCTGTGCTTCGCC
GCGACCATCAGCAACCGGCTCTGCGAGTTCGTCTTGTCCATCCCCGCCGGCTACCACACCGGGCAGCGCAGCGCC
CGCTACCAGCTGTGGATGTCTCCCTACATCGCCCTGTGCATCATCCGCTCCTTCATCCTGCCCACCTGGCTCGGC
GGCACGACGCAGGCCTTCAAGCCGACGGGCTCCCTCTCCTCGGCCCTCAACGAGCGCGACCCGGTCAGGAAGAAG
AACATGGTCCGCCGGCTCTGGGCCATCCTGGTCAACTACATGGGTGTCTTCCACCTGGCCTTTGTCTACCTGACG
CTGGTTGGCGTTGTCCTGACGTCGTTCCGCTGCTTCGTGCTGCAGAAGAGCACCAAGGACCTGCTGCTCGGCCTT
GTGACGCACGCCTTCTGGCCACCCTTGACGTTCATCTTCATCTGCAGCTCCCTCTGGGTCCCGATTGCGTACGCC
ATCGACCCCCCGATGATGCCGGATCGCGAGGAGCTGCTGGAGCGCGACCCAAAGACGATGGTCGCCCACCCCACG
GCTAAGAGCAAGAAGATTGCGTTCGGCGGCCAGGCGGCCTGGTTCGAGCTCGAGCTCACCACGACGACTCTCTAC
ACCGCATTCATTTTCGTTTTATCATTCGTCTTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail