Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1642
Gene name
LocationContig_137:31281..32948
Strand+
Gene length (bp)1667
Transcript length (bp)1452
Coding sequence length (bp)1452
Protein length (aa) 484

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13127 DUF3955 Protein of unknown function (DUF3955) 2.2E-08 70 125

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03730|YMB8_YEAST Uncharacterized vacuolar membrane protein YML018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML018C PE=1 SV=1 68 478 2.0E-73
sp|O94654|YGF3_SCHPO Uncharacterized transporter C405.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC405.03c PE=3 SV=1 61 452 7.0E-56
sp|Q8R314|S35F5_MOUSE Solute carrier family 35 member F5 OS=Mus musculus GN=Slc35f5 PE=2 SV=1 50 452 3.0E-48
sp|A6QL92|S35F5_BOVIN Solute carrier family 35 member F5 OS=Bos taurus GN=SLC35F5 PE=2 SV=1 208 449 1.0E-44
sp|Q4R794|S35F5_MACFA Solute carrier family 35 member F5 OS=Macaca fascicularis GN=SLC35F5 PE=2 SV=1 208 451 9.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03730|YMB8_YEAST Uncharacterized vacuolar membrane protein YML018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML018C PE=1 SV=1 68 478 2.0E-73
sp|O94654|YGF3_SCHPO Uncharacterized transporter C405.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC405.03c PE=3 SV=1 61 452 7.0E-56
sp|Q8R314|S35F5_MOUSE Solute carrier family 35 member F5 OS=Mus musculus GN=Slc35f5 PE=2 SV=1 50 452 3.0E-48
sp|A6QL92|S35F5_BOVIN Solute carrier family 35 member F5 OS=Bos taurus GN=SLC35F5 PE=2 SV=1 208 449 1.0E-44
sp|Q4R794|S35F5_MACFA Solute carrier family 35 member F5 OS=Macaca fascicularis GN=SLC35F5 PE=2 SV=1 208 451 9.0E-44
sp|Q5R6J3|S35F5_PONAB Solute carrier family 35 member F5 OS=Pongo abelii GN=SLC35F5 PE=2 SV=1 208 452 2.0E-43
sp|Q8WV83|S35F5_HUMAN Solute carrier family 35 member F5 OS=Homo sapiens GN=SLC35F5 PE=2 SV=1 208 452 1.0E-42
sp|Q04083|THI74_YEAST Thiamine-repressible mitochondrial transport protein THI74 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI74 PE=1 SV=1 82 480 1.0E-40
sp|Q8IY50|S35F3_HUMAN Putative thiamine transporter SLC35F3 OS=Homo sapiens GN=SLC35F3 PE=2 SV=2 221 444 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 71 93 22
2 103 125 22
3 272 290 18
4 305 327 22
5 344 366 22
6 398 420 22
7 432 451 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1642
MPTPTPPPPDSPGSASSVRRPSDATAGPVSERLRRSSAVLTASPFQRLTLSSEKEGFRSKMGLAGVARRTLGIGL
LLVTVFLWTTSNFLASFIFSDHTYDKPFFLVYVNSSVFAVALLPVFVRYMRRSGIRGLRHDVVRLWHEHRRQASM
LAKLPSAAVTGREAEEELAGTGAGTARERLLLNADGADDDDDDDGGSIDLGQRAPDEKLGFRETAGLSLEFCMLW
TLANYFASACLEHTSVASVTILTSTSSMWTLVFCAVYGVEAFSVRKLVGVMASLVGVALISTVDLSGESDENRGS
FPHKTPGQIAVGDAMALFSAVVYGMYVTVMKRRVGSEDRVDMRLFFGLVGVFNLALLWPLFFVLHWTGIEPFEMP
PTGKVWAVIIANSLASFVSDMSWAMAMLLTTPLVVTVGLSLTIPLSLVGEMIQYGQYSSFIYWIGAAVVFVSFLF
INNESYEDGGPGRRRGSEDGSADAAAARAGAAA*
Coding >Hirsu2|1642
ATGCCGACGCCGACGCCGCCGCCGCCGGATTCGCCGGGATCGGCTTCGAGTGTGAGGCGGCCCAGCGACGCCACC
GCCGGACCCGTATCAGAACGTCTCCGACGCTCCTCGGCCGTCTTGACGGCATCGCCCTTCCAGAGGCTGACCCTG
TCCTCGGAAAAGGAGGGATTCCGGTCCAAGATGGGCCTGGCCGGCGTTGCCAGGCGGACGCTCGGGATCGGTCTC
TTGCTCGTGACCGTCTTCCTGTGGACCACGTCCAACTTCCTCGCTAGCTTCATCTTCTCCGACCACACCTACGAC
AAGCCTTTCTTCCTCGTCTACGTCAACTCGTCCGTCTTCGCCGTCGCGTTGCTGCCCGTCTTCGTCCGATACATG
CGGAGGAGCGGCATCCGTGGCCTCCGCCACGACGTCGTGCGCCTATGGCACGAGCACAGACGACAGGCGAGCATG
CTTGCCAAGCTCCCCTCGGCGGCCGTGACGGGCCGGGAAGCGGAGGAGGAGTTGGCGGGGACGGGGGCGGGGACG
GCGCGCGAGCGCTTGCTGTTGAACGCTGACGGCGCCGACGATGACGACGACGATGACGGCGGCAGTATCGACCTG
GGCCAGCGAGCGCCGGACGAGAAATTGGGCTTCCGAGAGACGGCCGGGCTGAGCCTCGAGTTCTGCATGCTGTGG
ACGCTGGCCAACTACTTTGCGTCGGCCTGCCTGGAGCACACGAGCGTGGCGAGCGTGACGATCCTGACGTCGACG
AGCAGCATGTGGACGCTCGTCTTCTGCGCCGTCTACGGCGTCGAGGCCTTTTCGGTGCGCAAGCTGGTGGGCGTC
ATGGCGTCGCTGGTCGGCGTCGCCCTCATCTCGACCGTCGACCTGTCGGGCGAGAGCGACGAGAACCGCGGCTCG
TTCCCGCACAAGACGCCCGGGCAGATCGCCGTGGGCGACGCCATGGCCCTCTTCAGCGCCGTCGTCTACGGCATG
TACGTGACGGTGATGAAGAGGCGGGTCGGCAGCGAGGACCGGGTCGACATGCGCCTGTTCTTCGGCCTCGTCGGC
GTCTTCAACCTGGCCCTGCTGTGGCCGCTGTTCTTCGTCCTGCACTGGACCGGCATCGAACCGTTCGAGATGCCG
CCGACGGGCAAGGTTTGGGCCGTGATTATCGCCAACTCGCTGGCGTCGTTCGTCAGCGACATGTCGTGGGCGATG
GCGATGCTGCTGACGACGCCGCTGGTGGTGACGGTGGGCCTGTCGCTGACGATACCGCTGTCGCTGGTGGGCGAG
ATGATCCAGTACGGGCAGTACTCTAGCTTCATCTACTGGATCGGGGCCGCCGTCGTCTTCGTCTCCTTTCTCTTC
ATCAACAACGAGAGCTACGAGGACGGCGGGCCGGGCAGGAGGCGAGGCAGCGAGGACGGCAGCGCCGATGCAGCA
GCCGCCCGTGCCGGAGCTGCTGCCTAG
Transcript >Hirsu2|1642
ATGCCGACGCCGACGCCGCCGCCGCCGGATTCGCCGGGATCGGCTTCGAGTGTGAGGCGGCCCAGCGACGCCACC
GCCGGACCCGTATCAGAACGTCTCCGACGCTCCTCGGCCGTCTTGACGGCATCGCCCTTCCAGAGGCTGACCCTG
TCCTCGGAAAAGGAGGGATTCCGGTCCAAGATGGGCCTGGCCGGCGTTGCCAGGCGGACGCTCGGGATCGGTCTC
TTGCTCGTGACCGTCTTCCTGTGGACCACGTCCAACTTCCTCGCTAGCTTCATCTTCTCCGACCACACCTACGAC
AAGCCTTTCTTCCTCGTCTACGTCAACTCGTCCGTCTTCGCCGTCGCGTTGCTGCCCGTCTTCGTCCGATACATG
CGGAGGAGCGGCATCCGTGGCCTCCGCCACGACGTCGTGCGCCTATGGCACGAGCACAGACGACAGGCGAGCATG
CTTGCCAAGCTCCCCTCGGCGGCCGTGACGGGCCGGGAAGCGGAGGAGGAGTTGGCGGGGACGGGGGCGGGGACG
GCGCGCGAGCGCTTGCTGTTGAACGCTGACGGCGCCGACGATGACGACGACGATGACGGCGGCAGTATCGACCTG
GGCCAGCGAGCGCCGGACGAGAAATTGGGCTTCCGAGAGACGGCCGGGCTGAGCCTCGAGTTCTGCATGCTGTGG
ACGCTGGCCAACTACTTTGCGTCGGCCTGCCTGGAGCACACGAGCGTGGCGAGCGTGACGATCCTGACGTCGACG
AGCAGCATGTGGACGCTCGTCTTCTGCGCCGTCTACGGCGTCGAGGCCTTTTCGGTGCGCAAGCTGGTGGGCGTC
ATGGCGTCGCTGGTCGGCGTCGCCCTCATCTCGACCGTCGACCTGTCGGGCGAGAGCGACGAGAACCGCGGCTCG
TTCCCGCACAAGACGCCCGGGCAGATCGCCGTGGGCGACGCCATGGCCCTCTTCAGCGCCGTCGTCTACGGCATG
TACGTGACGGTGATGAAGAGGCGGGTCGGCAGCGAGGACCGGGTCGACATGCGCCTGTTCTTCGGCCTCGTCGGC
GTCTTCAACCTGGCCCTGCTGTGGCCGCTGTTCTTCGTCCTGCACTGGACCGGCATCGAACCGTTCGAGATGCCG
CCGACGGGCAAGGTTTGGGCCGTGATTATCGCCAACTCGCTGGCGTCGTTCGTCAGCGACATGTCGTGGGCGATG
GCGATGCTGCTGACGACGCCGCTGGTGGTGACGGTGGGCCTGTCGCTGACGATACCGCTGTCGCTGGTGGGCGAG
ATGATCCAGTACGGGCAGTACTCTAGCTTCATCTACTGGATCGGGGCCGCCGTCGTCTTCGTCTCCTTTCTCTTC
ATCAACAACGAGAGCTACGAGGACGGCGGGCCGGGCAGGAGGCGAGGCAGCGAGGACGGCAGCGCCGATGCAGCA
GCCGCCCGTGCCGGAGCTGCTGCCTAG
Gene >Hirsu2|1642
ATGCCGACGCCGACGCCGCCGCCGCCGGATTCGCCGGGATCGGCTTCGAGTGTGAGGCGGCCCAGCGACGCCACC
GCCGGACCCGTATCAGAACGTCTCCGACGCTCCTCGGCCGTCTTGACGGCATCGCCCTTCCAGAGGCTGACCCTG
TCCTCGGAAAAGGAGGGATTCCGGTCCAAGATGGGCCTGGCCGGCGTTGCCAGGCGGACGCTCGGGATCGGTCTC
TTGCTCGTGACCGTCTTCCTGTGGACCACGTCCAACTTCCTCGCTAGCGTACGTGACCCCCCGCGTGTGCTCTTT
TTTATTCTCCTGGCCGGGGAGAGCGGAGGACAGGCGGTATTGGGCTGGGACTGAGGCGGGCGAGACGCAGTTCAT
CTTCTCCGACCACACCTACGACAAGCCTTTCTTCCTCGTCTACGTCAACTCGTCCGTCTTCGCCGTCGCGTTGCT
GCCCGTCTTCGTCCGATACATGCGGAGGAGCGGCATCCGTGGCCTCCGCCACGACGTCGTGCGCCTATGGCACGA
GCACAGACGACAGGCGAGCATGCTTGCCAAGCTCCCCTCGGCGGCCGTGACGGGCCGGGAAGCGGAGGAGGAGTT
GGCGGGGACGGGGGCGGGGACGGCGCGCGAGCGCTTGCTGTTGAACGCTGACGGCGCCGACGATGACGACGACGA
TGACGGCGGCAGTATCGACCTGGGCCAGCGAGCGCCGGACGAGAAATTGGGCTTCCGAGAGACGGCCGGGCTGAG
CCTCGAGTTCTGCATGCTGTGGACGCTGGCCAACTACTTTGCGTCGGCCTGCCTGGAGCACACGAGCGTGGCGAG
CGTGACGATCCTGACGTCGACGAGCAGCATGTGGACGCTCGTCTTCTGCGCCGTCTACGGCGTCGAGGCCTTTTC
GGTGCGCAAGCTGGTGGGCGTCATGGCGTCGCTGGTCGGCGTCGCCCTCATCTCGACCGTCGACCTGTCGGGCGA
GAGCGACGAGAACCGCGGCTCGTTCCCGCACAAGACGCCCGGGCAGATCGCCGTGGGCGACGCCATGGCCCTCTT
CAGCGCCGTCGTCTACGGCATGTACGTGACGGTGATGAAGAGGCGGGTCGGCAGCGAGGACCGGGTCGACATGCG
CCTGTTCTTCGGCCTCGTCGGCGTCTTCAACCTGGCCCTGCTGTGGCCGCTGTTCTTCGTCCTGCACTGGACCGG
CATCGAACCGGTATGTCGCGTGGGACACTGGAGCGGCAGGCGGATGGACTTGCTGACCCGACGCGACGCCAGTTC
GAGATGCCGCCGACGGGCAAGGTTTGGGCCGTGATTATCGTACGTGCCCCCGACCGGACAGTGTGGCATCCGGGT
CTGTCGCTGACCGGGAGCAGGCCAACTCGCTGGCGTCGTTCGTCAGCGACATGTCGTGGGCGATGGCGATGCTGC
TGACGACGCCGCTGGTGGTGACGGTGGGCCTGTCGCTGACGATACCGCTGTCGCTGGTGGGCGAGATGATCCAGT
ACGGGCAGTACTCTAGCTTCATCTACTGGATCGGGGCCGCCGTCGTCTTCGTCTCCTTTCTCTTCATCAACAACG
AGAGCTACGAGGACGGCGGGCCGGGCAGGAGGCGAGGCAGCGAGGACGGCAGCGCCGATGCAGCAGCCGCCCGTG
CCGGAGCTGCTGCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail