Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1641
Gene name
LocationContig_137:29472..30512
Strand+
Gene length (bp)1040
Transcript length (bp)897
Coding sequence length (bp)897
Protein length (aa) 299

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09084 NMT1 NMT1/THI5 like 3.4E-05 24 234

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.7693 0.366 0.0793 0.167 0.1268 0.135 0.0761 0.1475 0.0388 0.3541

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1753
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2283
Ophiocordyceps australis map64 (Brazil) OphauB2|5989
Ophiocordyceps camponoti-floridani Ophcf2|06775
Ophiocordyceps camponoti-rufipedis Ophun1|5431
Ophiocordyceps kimflemingae Ophio5|2624
Ophiocordyceps subramaniannii Hirsu2|1641 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1641
MSPPLRIGYVPEHFSTPLYFAQKHYGLDATLIPFPSGTGHMVTAIRAGEIDVGIGLTEGWIAGLGKEDVEGDGGY
RLVGTYVETPLCWAISTGAHRPEITSVGSLEGRKIGVSRIGSGSFVMGFVLADQQGWLSKGPKQPFSETVVLHHF
DKLREAVNSGEADFFMWEHFTSKKHHDAGEIRRVGDIYTPWSSWKIVASTALAPRDGAVDARVRVLFEKLDRGVA
HFHEHPDEAVEYISTSLGYTEPDAREWLKTVAFPSRTEGVRSEVVSKCVAILRKAGVLAEGKGMAPEAMVVKS*
Coding >Hirsu2|1641
ATGTCTCCTCCTCTGCGCATCGGATACGTGCCCGAGCACTTCTCCACGCCGCTGTACTTTGCCCAGAAGCACTAT
GGGCTGGACGCCACCTTGATACCCTTCCCGTCCGGCACCGGCCACATGGTGACGGCCATCCGGGCCGGCGAGATC
GATGTCGGCATCGGCCTGACCGAGGGATGGATTGCCGGGCTCGGCAAGGAGGACGTCGAGGGCGACGGGGGCTAT
CGGCTGGTCGGCACCTACGTGGAAACGCCGCTCTGCTGGGCCATCTCGACCGGGGCCCATCGTCCCGAGATCACG
TCGGTCGGCTCGCTCGAGGGCCGCAAGATCGGCGTGTCGCGCATCGGCTCGGGCAGCTTCGTCATGGGCTTCGTC
CTGGCCGACCAGCAGGGCTGGCTGTCGAAGGGGCCGAAGCAGCCCTTCTCCGAGACGGTCGTGCTGCACCACTTC
GACAAGCTCCGCGAGGCCGTCAACTCGGGCGAGGCCGACTTCTTCATGTGGGAGCACTTCACGTCCAAGAAACAC
CACGACGCGGGCGAGATCCGCCGCGTCGGCGACATCTACACGCCCTGGAGCAGCTGGAAGATCGTGGCCTCGACG
GCGCTGGCCCCCCGCGACGGCGCCGTCGACGCCCGCGTGCGGGTCCTGTTCGAGAAGCTGGACCGGGGCGTCGCG
CACTTCCACGAGCACCCGGACGAGGCCGTCGAGTACATCTCCACCAGCCTGGGCTACACGGAGCCGGACGCGAGA
GAGTGGCTGAAGACGGTGGCGTTCCCGTCCAGGACCGAGGGCGTCCGGTCCGAGGTCGTGTCCAAGTGCGTGGCC
ATCCTGAGAAAGGCGGGCGTCCTGGCAGAGGGGAAAGGCATGGCGCCCGAGGCCATGGTGGTCAAGTCGTGA
Transcript >Hirsu2|1641
ATGTCTCCTCCTCTGCGCATCGGATACGTGCCCGAGCACTTCTCCACGCCGCTGTACTTTGCCCAGAAGCACTAT
GGGCTGGACGCCACCTTGATACCCTTCCCGTCCGGCACCGGCCACATGGTGACGGCCATCCGGGCCGGCGAGATC
GATGTCGGCATCGGCCTGACCGAGGGATGGATTGCCGGGCTCGGCAAGGAGGACGTCGAGGGCGACGGGGGCTAT
CGGCTGGTCGGCACCTACGTGGAAACGCCGCTCTGCTGGGCCATCTCGACCGGGGCCCATCGTCCCGAGATCACG
TCGGTCGGCTCGCTCGAGGGCCGCAAGATCGGCGTGTCGCGCATCGGCTCGGGCAGCTTCGTCATGGGCTTCGTC
CTGGCCGACCAGCAGGGCTGGCTGTCGAAGGGGCCGAAGCAGCCCTTCTCCGAGACGGTCGTGCTGCACCACTTC
GACAAGCTCCGCGAGGCCGTCAACTCGGGCGAGGCCGACTTCTTCATGTGGGAGCACTTCACGTCCAAGAAACAC
CACGACGCGGGCGAGATCCGCCGCGTCGGCGACATCTACACGCCCTGGAGCAGCTGGAAGATCGTGGCCTCGACG
GCGCTGGCCCCCCGCGACGGCGCCGTCGACGCCCGCGTGCGGGTCCTGTTCGAGAAGCTGGACCGGGGCGTCGCG
CACTTCCACGAGCACCCGGACGAGGCCGTCGAGTACATCTCCACCAGCCTGGGCTACACGGAGCCGGACGCGAGA
GAGTGGCTGAAGACGGTGGCGTTCCCGTCCAGGACCGAGGGCGTCCGGTCCGAGGTCGTGTCCAAGTGCGTGGCC
ATCCTGAGAAAGGCGGGCGTCCTGGCAGAGGGGAAAGGCATGGCGCCCGAGGCCATGGTGGTCAAGTCGTGA
Gene >Hirsu2|1641
ATGTCTCCTCCTCTGCGCATCGGATACGTGCCCGAGCACTTCTCCACGCCGCTGTACTTTGCCCAGAAGCACTAT
GGGCTGGACGCCACCTTGATACCCTTCCCGTCCGGCACCGGCCACATGGTGACGGCCATCCGGGCCGGCGAGATC
GATGTCGGCATCGGCCTGACCGAGGGATGGATTGCCGGGCTCGGCAAGGAGGACGTCGAGGGCGACGGGGGCTAT
CGGCTGGTCGGCACCTACGTGGAAACGCCGCTCTGTACGTCCGAGGAGGAAGGAGAAAAAGAGGCTGCACGGCCC
TCTCTCCCTGCCTCTCCCTGAGACCGTCTCCCTGCCCCTTCTGCCCCTCTCTTTCTGCCGTCTTGATTGTGTGTC
TGACCGCGGGCGGGGCGTGCATCGCAGGCTGGGCCATCTCGACCGGGGCCCATCGTCCCGAGATCACGTCGGTCG
GCTCGCTCGAGGGCCGCAAGATCGGCGTGTCGCGCATCGGCTCGGGCAGCTTCGTCATGGGCTTCGTCCTGGCCG
ACCAGCAGGGCTGGCTGTCGAAGGGGCCGAAGCAGCCCTTCTCCGAGACGGTCGTGCTGCACCACTTCGACAAGC
TCCGCGAGGCCGTCAACTCGGGCGAGGCCGACTTCTTCATGTGGGAGCACTTCACGTCCAAGAAACACCACGACG
CGGGCGAGATCCGCCGCGTCGGCGACATCTACACGCCCTGGAGCAGCTGGAAGATCGTGGCCTCGACGGCGCTGG
CCCCCCGCGACGGCGCCGTCGACGCCCGCGTGCGGGTCCTGTTCGAGAAGCTGGACCGGGGCGTCGCGCACTTCC
ACGAGCACCCGGACGAGGCCGTCGAGTACATCTCCACCAGCCTGGGCTACACGGAGCCGGACGCGAGAGAGTGGC
TGAAGACGGTGGCGTTCCCGTCCAGGACCGAGGGCGTCCGGTCCGAGGTCGTGTCCAAGTGCGTGGCCATCCTGA
GAAAGGCGGGCGTCCTGGCAGAGGGGAAAGGCATGGCGCCCGAGGCCATGGTGGTCAAGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail