Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1640
Gene name
LocationContig_137:26560..28212
Strand-
Gene length (bp)1652
Transcript length (bp)1491
Coding sequence length (bp)1491
Protein length (aa) 497

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.5E-28 103 442

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 95 256 3.0E-06
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 97 314 4.0E-06

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 41 63 22
2 104 126 22
3 135 154 19
4 169 191 22
5 204 226 22
6 230 252 22
7 291 313 22
8 328 350 22
9 362 384 22
10 394 416 22
11 428 450 22
12 460 482 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1640
MMTVGRDVPEDAPLLGRDELQDEPLPSSAARPKPWLAKTPGTMILLMTIVKFGVTTSGMLILIPMYRLIEDVLCH
AHYHDSSPGLIDEMRCKGDEVQSRLAFMVGWFGLFNSILTLLVSFPYGLLADRIGRKPMALMAYGGTTAACYFAA
LMLGRMQAQLRSNPYLLMTVSLFLLFGGGIPVLIATLYAMAADVSSEEEKATSFLYLSFGVTAGVLVGPLLGGLL
MERYGPWAPIYVVLAISPAILGLIGLIPETLVVEAARQGPELGLGEHVAEGLRDLVRSVALVRDPNVLLVLVTFL
FQNAKFVAYTSTLTQYLSKRFGWRLAETSLLLSPLGIVNLAVLLALSGVSRVLTSSPRLRLGTFGKDLLLAQAST
VLILAGALLQGLSSDVGLFLLGLFVGALGFADAPLARAAVSHHVEPRLTSRLYALVSMTEALGSFLAGPALAWLF
RQGLRWGGLWMGLPWLYIAFLSVVTLAVLLFVRPPRGSGRVCADMD*
Coding >Hirsu2|1640
ATGATGACAGTTGGACGGGACGTGCCTGAAGATGCTCCGCTACTGGGACGGGATGAGCTACAGGACGAGCCGCTG
CCCTCGTCGGCGGCGAGGCCGAAACCCTGGCTGGCCAAGACGCCTGGCACCATGATCCTCCTCATGACGATTGTC
AAGTTCGGCGTCACGACGAGCGGTATGCTCATCCTCATCCCCATGTACCGGCTCATCGAAGACGTCCTCTGCCAC
GCCCACTACCACGACAGCTCTCCCGGCCTCATCGATGAGATGAGGTGCAAGGGCGACGAGGTCCAGTCGCGGCTG
GCCTTTATGGTCGGCTGGTTTGGCCTCTTCAACTCCATCCTGACTCTGCTCGTGTCTTTTCCATACGGGCTGCTC
GCCGATCGCATCGGTCGCAAGCCAATGGCCCTGATGGCCTACGGCGGCACCACGGCCGCCTGCTACTTCGCCGCG
CTCATGCTCGGCAGGATGCAGGCCCAGCTGCGCAGCAACCCGTACCTGCTGATGACCGTCTCCCTGTTCCTGCTC
TTCGGCGGCGGCATCCCCGTCTTGATCGCCACGCTGTACGCCATGGCGGCCGACGTCAGCTCGGAAGAAGAAAAG
GCCACGAGCTTTCTGTACCTGAGCTTTGGCGTCACCGCCGGCGTGCTCGTCGGCCCGCTGCTGGGCGGCCTTCTG
ATGGAGAGGTACGGGCCGTGGGCGCCCATCTACGTCGTCCTGGCCATCTCGCCGGCCATCCTCGGCCTCATCGGG
CTGATCCCGGAGACGCTGGTGGTCGAGGCCGCTCGACAAGGCCCCGAGCTCGGCCTCGGAGAGCACGTCGCCGAG
GGGCTTCGCGACCTGGTCCGGTCCGTCGCCCTGGTCAGGGACCCCAACGTCCTGCTCGTCCTGGTCACGTTCCTC
TTCCAGAACGCCAAGTTCGTGGCCTACACCTCGACCCTGACGCAGTACCTCAGCAAGCGGTTCGGCTGGCGGCTG
GCGGAGACGAGCCTGCTGCTCTCGCCGCTCGGCATCGTCAACCTCGCCGTGCTGCTGGCCCTGTCCGGCGTGTCG
CGGGTGCTGACGTCGTCGCCGCGCCTCCGCCTCGGCACCTTCGGCAAGGACCTGCTGCTGGCCCAGGCCTCGACC
GTGCTCATCCTCGCCGGCGCCCTGCTGCAGGGCCTGAGCTCGGACGTCGGCCTGTTCCTGCTGGGCCTGTTCGTC
GGCGCCCTGGGCTTCGCCGACGCGCCGCTCGCCCGCGCCGCCGTCTCGCACCACGTCGAGCCGCGACTCACCAGC
CGGCTCTACGCCCTCGTCAGCATGACCGAGGCGCTCGGCTCTTTCCTCGCCGGGCCGGCTCTGGCCTGGCTCTTC
CGCCAGGGCCTGCGCTGGGGGGGCCTCTGGATGGGCCTGCCTTGGCTGTACATTGCCTTTCTCTCCGTCGTCACG
CTGGCCGTCTTGCTGTTCGTCCGGCCGCCGAGGGGGAGCGGGCGTGTGTGTGCGGACATGGATTAG
Transcript >Hirsu2|1640
ATGATGACAGTTGGACGGGACGTGCCTGAAGATGCTCCGCTACTGGGACGGGATGAGCTACAGGACGAGCCGCTG
CCCTCGTCGGCGGCGAGGCCGAAACCCTGGCTGGCCAAGACGCCTGGCACCATGATCCTCCTCATGACGATTGTC
AAGTTCGGCGTCACGACGAGCGGTATGCTCATCCTCATCCCCATGTACCGGCTCATCGAAGACGTCCTCTGCCAC
GCCCACTACCACGACAGCTCTCCCGGCCTCATCGATGAGATGAGGTGCAAGGGCGACGAGGTCCAGTCGCGGCTG
GCCTTTATGGTCGGCTGGTTTGGCCTCTTCAACTCCATCCTGACTCTGCTCGTGTCTTTTCCATACGGGCTGCTC
GCCGATCGCATCGGTCGCAAGCCAATGGCCCTGATGGCCTACGGCGGCACCACGGCCGCCTGCTACTTCGCCGCG
CTCATGCTCGGCAGGATGCAGGCCCAGCTGCGCAGCAACCCGTACCTGCTGATGACCGTCTCCCTGTTCCTGCTC
TTCGGCGGCGGCATCCCCGTCTTGATCGCCACGCTGTACGCCATGGCGGCCGACGTCAGCTCGGAAGAAGAAAAG
GCCACGAGCTTTCTGTACCTGAGCTTTGGCGTCACCGCCGGCGTGCTCGTCGGCCCGCTGCTGGGCGGCCTTCTG
ATGGAGAGGTACGGGCCGTGGGCGCCCATCTACGTCGTCCTGGCCATCTCGCCGGCCATCCTCGGCCTCATCGGG
CTGATCCCGGAGACGCTGGTGGTCGAGGCCGCTCGACAAGGCCCCGAGCTCGGCCTCGGAGAGCACGTCGCCGAG
GGGCTTCGCGACCTGGTCCGGTCCGTCGCCCTGGTCAGGGACCCCAACGTCCTGCTCGTCCTGGTCACGTTCCTC
TTCCAGAACGCCAAGTTCGTGGCCTACACCTCGACCCTGACGCAGTACCTCAGCAAGCGGTTCGGCTGGCGGCTG
GCGGAGACGAGCCTGCTGCTCTCGCCGCTCGGCATCGTCAACCTCGCCGTGCTGCTGGCCCTGTCCGGCGTGTCG
CGGGTGCTGACGTCGTCGCCGCGCCTCCGCCTCGGCACCTTCGGCAAGGACCTGCTGCTGGCCCAGGCCTCGACC
GTGCTCATCCTCGCCGGCGCCCTGCTGCAGGGCCTGAGCTCGGACGTCGGCCTGTTCCTGCTGGGCCTGTTCGTC
GGCGCCCTGGGCTTCGCCGACGCGCCGCTCGCCCGCGCCGCCGTCTCGCACCACGTCGAGCCGCGACTCACCAGC
CGGCTCTACGCCCTCGTCAGCATGACCGAGGCGCTCGGCTCTTTCCTCGCCGGGCCGGCTCTGGCCTGGCTCTTC
CGCCAGGGCCTGCGCTGGGGGGGCCTCTGGATGGGCCTGCCTTGGCTGTACATTGCCTTTCTCTCCGTCGTCACG
CTGGCCGTCTTGCTGTTCGTCCGGCCGCCGAGGGGGAGCGGGCGTGTGTGTGCGGACATGGATTAG
Gene >Hirsu2|1640
ATGATGACAGTTGGACGGGACGTGCCTGAAGATGCTCCGCTACTGGGACGGGATGAGCTACAGGACGAGCCGCTG
CCCTCGTCGGCGGCGAGGCCGAAACCCTGGCTGGCCAAGACGCCTGGCACCATGATCCTCCTCATGACGATTGTC
AAGTTCGGCGTCACGACGAGCGGTATGCTCATCCTCATCCCCATGTACCGGCTCATCGAAGACGTCCTCTGCCAC
GCCCACTACCACGACAGCTCTCCCGGCCTCATCGATGAGATGAGGTGCAAGGGCGACGAGGTCCAGTCGCGGCTG
GCCTTTATGGTCGGCTGGTTTGGCCTCTTCAACTCCATCCTGAGTGCGCCCGCCCCCTTTTCGAGGAGCCTCGCA
CCGCCCTCCCTATGCTGACGAGGTTTTATTTTATTTTTTCCACTCGTCTTGCTCCATTCCCCAGCTCTGCTCGTG
TCTTTTCCATACGGGCTGCTCGCCGATCGCATCGGTCGCAAGCCAATGGCCCTGATGGCCTACGGCGGCACCACG
GCCGCCTGCTACTTCGCCGCGCTCATGCTCGGCAGGATGCAGGCCCAGCTGCGCAGCAACCCGTACCTGCTGATG
ACCGTCTCCCTGTTCCTGCTCTTCGGCGGCGGCATCCCCGTCTTGATCGCCACGCTGTACGCCATGGCGGCCGAC
GTCAGCTCGGAAGAAGAAAAGTGAGGACGGCCCGAGGCGCGTTCCCCGATCGGTACGCACCACTCACACTGACTC
TGCCGCGCAGGGCCACGAGCTTTCTGTACCTGAGCTTTGGCGTCACCGCCGGCGTGCTCGTCGGCCCGCTGCTGG
GCGGCCTTCTGATGGAGAGGTACGGGCCGTGGGCGCCCATCTACGTCGTCCTGGCCATCTCGCCGGCCATCCTCG
GCCTCATCGGGCTGATCCCGGAGACGCTGGTGGTCGAGGCCGCTCGACAAGGCCCCGAGCTCGGCCTCGGAGAGC
ACGTCGCCGAGGGGCTTCGCGACCTGGTCCGGTCCGTCGCCCTGGTCAGGGACCCCAACGTCCTGCTCGTCCTGG
TCACGTTCCTCTTCCAGAACGCCAAGTTCGTGGCCTACACCTCGACCCTGACGCAGTACCTCAGCAAGCGGTTCG
GCTGGCGGCTGGCGGAGACGAGCCTGCTGCTCTCGCCGCTCGGCATCGTCAACCTCGCCGTGCTGCTGGCCCTGT
CCGGCGTGTCGCGGGTGCTGACGTCGTCGCCGCGCCTCCGCCTCGGCACCTTCGGCAAGGACCTGCTGCTGGCCC
AGGCCTCGACCGTGCTCATCCTCGCCGGCGCCCTGCTGCAGGGCCTGAGCTCGGACGTCGGCCTGTTCCTGCTGG
GCCTGTTCGTCGGCGCCCTGGGCTTCGCCGACGCGCCGCTCGCCCGCGCCGCCGTCTCGCACCACGTCGAGCCGC
GACTCACCAGCCGGCTCTACGCCCTCGTCAGCATGACCGAGGCGCTCGGCTCTTTCCTCGCCGGGCCGGCTCTGG
CCTGGCTCTTCCGCCAGGGCCTGCGCTGGGGGGGCCTCTGGATGGGCCTGCCTTGGCTGTACATTGCCTTTCTCT
CCGTCGTCACGCTGGCCGTCTTGCTGTTCGTCCGGCCGCCGAGGGGGAGCGGGCGTGTGTGTGCGGACATGGATT
AG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail