Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|164
Gene name
LocationContig_1027:5938..6669
Strand-
Gene length (bp)731
Transcript length (bp)396
Coding sequence length (bp)396
Protein length (aa) 132

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08507 COPI_assoc COPI associated protein 9.4E-32 6 123

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14223|TVP15_SCHPO Golgi apparatus membrane protein tvp15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tvp15 PE=3 SV=2 1 122 3.0E-18
sp|Q03860|TVP15_YEAST Golgi apparatus membrane protein TVP15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TVP15 PE=1 SV=1 7 119 9.0E-16

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 33 52 19
3 65 87 22
4 91 109 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|164
MELSDTFRIVNLVVGAITVLGGIAQIFGFKLQTIVVGAYMIVFGLAIALLEFQIPPQISRYASFLFSFVGRGAFY
IFLGCLLLGGMILQNIAGGIVGIVGIGYVVLEFIPSIEPPANMREADVAGWGAEQV*
Coding >Hirsu2|164
ATGGAGCTCTCCGACACGTTTCGCATCGTCAACCTGGTCGTCGGCGCCATCACCGTCCTCGGCGGCATCGCGCAG
ATCTTCGGTTTCAAACTCCAAACGATCGTCGTCGGCGCCTACATGATTGTTTTCGGCCTCGCCATCGCCTTGTTG
GAATTCCAGATCCCCCCGCAAATTTCCCGATATGCTTCTTTCCTCTTCTCTTTCGTCGGCCGCGGCGCCTTCTAC
ATCTTCCTCGGCTGCTTGCTCCTGGGCGGCATGATCCTCCAGAACATCGCGGGCGGCATCGTTGGCATCGTCGGC
ATCGGATACGTCGTCCTCGAGTTCATCCCCTCCATCGAACCCCCAGCCAACATGCGCGAGGCCGATGTCGCCGGC
TGGGGTGCCGAGCAGGTCTAA
Transcript >Hirsu2|164
ATGGAGCTCTCCGACACGTTTCGCATCGTCAACCTGGTCGTCGGCGCCATCACCGTCCTCGGCGGCATCGCGCAG
ATCTTCGGTTTCAAACTCCAAACGATCGTCGTCGGCGCCTACATGATTGTTTTCGGCCTCGCCATCGCCTTGTTG
GAATTCCAGATCCCCCCGCAAATTTCCCGATATGCTTCTTTCCTCTTCTCTTTCGTCGGCCGCGGCGCCTTCTAC
ATCTTCCTCGGCTGCTTGCTCCTGGGCGGCATGATCCTCCAGAACATCGCGGGCGGCATCGTTGGCATCGTCGGC
ATCGGATACGTCGTCCTCGAGTTCATCCCCTCCATCGAACCCCCAGCCAACATGCGCGAGGCCGATGTCGCCGGC
TGGGGTGCCGAGCAGGTCTAA
Gene >Hirsu2|164
ATGGAGCTCTCCGACACGTTGTATGTGCTGCTTGCTGGCCGACTTCTCGCCCTCTCCCCCCCCCTTGAGCACGCA
TCCTCTTCCAATTGGAGCTGCAAACTGACCGTGTCCGCTTCGGCGGCTCTAGTCGCATCGTCAACCTGGTCGTCG
GCGCCATCACCGTCCTCGGCGGCATCGCGCAGATCTTCGGTTTCAAACTGTGCGTCTTCGATCCCTGCTGCTTTT
TTGCGAATCCCGTTCCCCGGTCGCCCATGCGTCCGTCGCCCGACTCGCGCTGACTCCTGCGCAGCCAAACGATCG
TCGTCGGCGCCTACATGATTGTTTTCGGCCTCGCCATCGCCTTGTTGGGTACGAAAAGCCCTGCCTCTCTCTCTC
TCTCCCTCGCCTTGCGACGTGGCCCGTCGCTGTGCTAACGCCCCGGAACTAGAATTCCAGATCCCCCCGCAAATT
TCCCGATATGCTTCTTTCCTCTTCTCTTTCGTCGGCCGCGGCGCCTGTAAGTCGTACCCATTCTCACTCGTTCGC
CACGCTGGCTGGGCTGTTGACCCTGTCTAGTCTACATCTTCCTCGGCTGCTTGCTCCTGGGCGGCATGATCCTCC
AGAACATCGCGGGCGGCATCGTTGGCATCGTCGGCATCGGATACGTCGTCCTCGAGTTCATCCCCTCCATCGAAC
CCCCAGCCAACATGCGCGAGGCCGATGTCGCCGGCTGGGGTGCCGAGCAGGTCTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail