Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1635
Gene name
LocationContig_137:10829..11636
Strand+
Gene length (bp)807
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18142 SLATT_fungal SMODS and SLOG-associating 2TM effector domain 1.5E-31 102 219

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 116 138 22
2 143 165 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1635
MSEIIRRSSRWILERCISALDREEQGFPPQNSNYDAGITDNGTTTPAPPRSLTVVTTDAAALIPSNDKLLIYRSL
TGIDTVPALTSAGHAQRAAPNLGIYPRAVNAERSAARSYRFFNVAVNACLGLQIIVAASLTALGAANGSRAAVTG
FGAINTIVAGILTYLKGSGLPNRLKYVEDEFKLVREYAEQREREFCLAGCPLDPLHEVQTVEDMYRAAKLQMQNQ
KTPGAGGGGGGQPPRVSSMALSSLAQRFSRMTDTTHVPPPEKH*
Coding >Hirsu2|1635
ATGAGTGAGATTATCAGACGCTCCTCTCGCTGGATCCTCGAGCGCTGCATATCGGCGCTTGACCGGGAAGAACAA
GGCTTCCCCCCGCAAAACAGCAACTATGATGCGGGCATCACAGACAACGGCACGACGACGCCAGCACCGCCCCGA
TCGCTGACCGTCGTCACGACCGACGCCGCCGCCCTCATCCCCTCCAACGACAAGCTCCTCATCTATCGCTCCCTC
ACGGGCATCGACACCGTCCCGGCCCTCACGAGCGCCGGCCACGCCCAGCGCGCGGCGCCCAACCTCGGCATCTAC
CCTCGCGCCGTCAACGCCGAGCGCTCCGCCGCCCGCAGCTACCGCTTCTTCAACGTGGCCGTCAACGCCTGCCTC
GGCCTGCAGATCATCGTCGCCGCGTCGCTGACGGCCCTCGGCGCCGCCAACGGCTCCCGCGCCGCCGTCACGGGC
TTTGGCGCCATCAACACCATCGTCGCCGGCATCCTGACCTACCTCAAGGGCTCCGGCTTGCCGAACCGCCTCAAG
TACGTCGAGGACGAGTTCAAGCTGGTGAGGGAGTATGCGGAGCAGCGCGAGAGGGAGTTTTGTCTCGCTGGCTGT
CCGCTCGATCCGCTGCACGAGGTTCAGACCGTCGAGGACATGTACAGGGCCGCCAAGCTGCAGATGCAAAACCAG
AAGACTCCCGGCGCAGGCGGCGGCGGCGGCGGACAGCCTCCGCGCGTCTCGTCCATGGCTTTGTCGTCGTTGGCG
CAACGCTTCTCCCGAATGACTGACACGACGCATGTGCCTCCGCCGGAGAAGCACTAG
Transcript >Hirsu2|1635
ATGAGTGAGATTATCAGACGCTCCTCTCGCTGGATCCTCGAGCGCTGCATATCGGCGCTTGACCGGGAAGAACAA
GGCTTCCCCCCGCAAAACAGCAACTATGATGCGGGCATCACAGACAACGGCACGACGACGCCAGCACCGCCCCGA
TCGCTGACCGTCGTCACGACCGACGCCGCCGCCCTCATCCCCTCCAACGACAAGCTCCTCATCTATCGCTCCCTC
ACGGGCATCGACACCGTCCCGGCCCTCACGAGCGCCGGCCACGCCCAGCGCGCGGCGCCCAACCTCGGCATCTAC
CCTCGCGCCGTCAACGCCGAGCGCTCCGCCGCCCGCAGCTACCGCTTCTTCAACGTGGCCGTCAACGCCTGCCTC
GGCCTGCAGATCATCGTCGCCGCGTCGCTGACGGCCCTCGGCGCCGCCAACGGCTCCCGCGCCGCCGTCACGGGC
TTTGGCGCCATCAACACCATCGTCGCCGGCATCCTGACCTACCTCAAGGGCTCCGGCTTGCCGAACCGCCTCAAG
TACGTCGAGGACGAGTTCAAGCTGGTGAGGGAGTATGCGGAGCAGCGCGAGAGGGAGTTTTGTCTCGCTGGCTGT
CCGCTCGATCCGCTGCACGAGGTTCAGACCGTCGAGGACATGTACAGGGCCGCCAAGCTGCAGATGCAAAACCAG
AAGACTCCCGGCGCAGGCGGCGGCGGCGGCGGACAGCCTCCGCGCGTCTCGTCCATGGCTTTGTCGTCGTTGGCG
CAACGCTTCTCCCGAATGACTGACACGACGCATGTGCCTCCGCCGGAGAAGCACTAG
Gene >Hirsu2|1635
ATGAGTGAGATTATCAGACGCTCCTCTCGCTGGATCCTCGAGCGCTGCATATCGGCGCTTGACCGGGAAGAACAA
GGCTTCCCCCCGCAAAACAGCAACTATGATGCGGGCATCACAGACAACGGCACGACGACGCCAGCACCGCCCCGA
TCGCTGACCGTCGTCACGACCGACGCCGCCGCCCTCATCCCCTCCAACGACAAGCTCCTCATCTATCGCTCCCTC
ACGGGCATCGACACCGTCCCGGCCCTCACGAGCGCCGGCCACGCCCAGCGCGCGGCGCCCAACCTCGGCATCTAC
CCTCGCGCCGTCAACGCCGAGCGCTCCGCCGCCCGCAGCTACCGCTTCTTCAACGTGGCCGTCAACGCCTGCCTC
GGCCTGCAGATCATCGTCGCCGCGTCGCTGACGGCCCTCGGCGCCGCCAACGGCTCCCGCGCCGCCGTCACGGGC
TTTGGCGCCATCAACACCATCGTCGCCGGCATCCTGACCTACCTCAAGGGCTCCGGCTTGCCGAACCGCCTCAAG
TACGTCGAGGACGAGTTCAAGCTGGTGAGGGAGTATGCGGAGCAGCGCGAGAGGGAGTTTTGTCTCGCTGGCTGT
CCGCTCGATCCGCTGCACGAGGTTCAGACCGTCGAGGACATGTACAGGGCCGCCAAGCTGCAGATGCAAAACCAG
AAGACTCCCGGCGCAGGCGGCGGCGGCGGCGGACAGCCTCCGCGCGTCTCGTCCATGGCTTTGTCGTCGTTGGCG
CAACGCTTCTCCCGAATGACTGACACGACGCATGTGCCTCCGCCGGAGAAGCACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail