Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1620
Gene name
LocationContig_1363:4285..5374
Strand-
Gene length (bp)1089
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04795 PAPA-1 PAPA-1-like conserved region 3.3E-28 206 287

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14210|IES2_SCHPO INO80 complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ies2 PE=1 SV=1 168 289 1.0E-09
sp|P0C6U3|R1A_CVHN1 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N1) GN=1a PE=1 SV=1 63 161 2.0E-08
sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N2) GN=rep PE=3 SV=1 63 161 2.0E-08
sp|P0C6U4|R1A_CVHN2 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N2) GN=1a PE=3 SV=1 63 161 2.0E-08
sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N1) GN=rep PE=3 SV=1 63 161 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14210|IES2_SCHPO INO80 complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ies2 PE=1 SV=1 168 289 1.0E-09
sp|P0C6U3|R1A_CVHN1 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N1) GN=1a PE=1 SV=1 63 161 2.0E-08
sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N2) GN=rep PE=3 SV=1 63 161 2.0E-08
sp|P0C6U4|R1A_CVHN2 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N2) GN=1a PE=3 SV=1 63 161 2.0E-08
sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N1) GN=rep PE=3 SV=1 63 161 2.0E-08
sp|P40154|IES2_YEAST Ino eighty subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IES2 PE=1 SV=1 199 244 4.0E-08
sp|P0C6U3|R1A_CVHN1 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N1) GN=1a PE=1 SV=1 63 161 4.0E-08
sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N1) GN=rep PE=3 SV=1 63 161 4.0E-08
sp|P0C6U3|R1A_CVHN1 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N1) GN=1a PE=1 SV=1 63 161 8.0E-08
sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N1) GN=rep PE=3 SV=1 63 161 8.0E-08
sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N5) GN=rep PE=3 SV=1 61 161 9.0E-08
sp|P0C6U5|R1A_CVHN5 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N5) GN=1a PE=3 SV=1 61 161 9.0E-08
sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N1) GN=rep PE=3 SV=1 61 161 2.0E-07
sp|P0C6U4|R1A_CVHN2 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N2) GN=1a PE=3 SV=1 61 161 2.0E-07
sp|P0C6U3|R1A_CVHN1 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N1) GN=1a PE=1 SV=1 61 161 2.0E-07
sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N2) GN=rep PE=3 SV=1 61 161 2.0E-07
sp|P0C6U4|R1A_CVHN2 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N2) GN=1a PE=3 SV=1 63 162 4.0E-07
sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N2) GN=rep PE=3 SV=1 63 162 4.0E-07
sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N1) GN=rep PE=3 SV=1 63 162 2.0E-06
sp|P0C6U3|R1A_CVHN1 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N1) GN=1a PE=1 SV=1 63 162 2.0E-06
sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N5) GN=rep PE=3 SV=1 58 164 5.0E-06
sp|P0C6U5|R1A_CVHN5 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N5) GN=1a PE=3 SV=1 58 164 5.0E-06
sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N2) GN=rep PE=3 SV=1 58 161 1.0E-05
sp|P0C6U4|R1A_CVHN2 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N2) GN=1a PE=3 SV=1 58 161 1.0E-05
sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N1) GN=rep PE=3 SV=1 58 161 1.0E-05
sp|P0C6U3|R1A_CVHN1 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N1) GN=1a PE=1 SV=1 58 161 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0031011 Ino80 complex Yes
GO:0044446 intracellular organelle part No
GO:0044454 nuclear chromosome part No
GO:1902494 catalytic complex No
GO:1904949 ATPase complex No
GO:0070603 SWI/SNF superfamily-type complex No
GO:0044464 cell part No
GO:0032991 protein-containing complex No
GO:0033202 DNA helicase complex No
GO:0097346 INO80-type complex No
GO:0044424 intracellular part No
GO:0044422 organelle part No
GO:0044428 nuclear part No
GO:0005575 cellular_component No
GO:0044427 chromosomal part No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1620
MEVDAEGEDIDAEGEDAEGEDAEGDIEMDAPTAPTAPTIRVSQPSTARSAARAAASKIAAEEADDDDDDDDDDDD
DDDDDDADDDDDDGDEDGDGDGDDDGDGDDDDEDDDDLSDPGESDTAGDQMTGIRDEAMVDEDAEGEEIEVAGGE
DAEEVEPDSEDNGSQAETPDLTKMTKRQRARFKDEPQEYMKLSDEVQVKKHFTAEELSMRRQEMARRRRNLSEKR
NEEVKMETINKLLKKQAPKINRKSAAGAARGGSPDEEEHRSNPILIHWVNNRNGSRLAVPNDIVYGPAGEVFNKA
AGLASGKMAEEVI*
Coding >Hirsu2|1620
ATGGAGGTCGACGCAGAAGGAGAAGACATTGACGCTGAGGGTGAAGATGCCGAGGGAGAGGATGCTGAAGGCGAC
ATCGAGATGGATGCACCCACAGCCCCCACCGCTCCCACCATCAGGGTCTCCCAGCCTTCGACAGCTCGGTCAGCA
GCCAGGGCTGCCGCCTCCAAGATCGCCGCGGAGGAGGCCGACGACGACGACGACGACGACGACGACGACGACGAC
GACGACGACGACGACGATGCTGACGACGACGACGACGACGGTGATGAAGACGGCGACGGCGACGGCGATGACGAT
GGCGACGGCGACGATGACGATGAAGACGACGACGACCTCAGCGATCCTGGCGAAAGCGATACCGCCGGTGACCAA
ATGACAGGTATTAGAGATGAGGCCATGGTAGATGAGGATGCCGAGGGCGAGGAGATTGAGGTGGCAGGTGGGGAA
GATGCGGAAGAGGTCGAGCCGGATAGCGAAGATAATGGCAGCCAAGCTGAAACCCCGGACCTCACCAAAATGACA
AAACGCCAGCGTGCCCGCTTCAAGGACGAACCTCAGGAGTACATGAAGCTCTCAGACGAGGTTCAGGTCAAGAAG
CATTTCACCGCTGAAGAGCTGTCCATGCGCCGGCAAGAAATGGCCCGCCGCCGGCGCAACCTCAGCGAGAAGCGA
AACGAAGAAGTCAAGATGGAAACCATCAACAAGCTCCTGAAGAAGCAAGCACCCAAGATTAACCGTAAATCGGCG
GCGGGGGCAGCCCGAGGGGGTAGCCCGGATGAGGAGGAGCATAGGTCCAATCCCATCCTCATCCACTGGGTGAAT
AACAGAAATGGGAGTCGGCTGGCTGTACCCAATGATATTGTGTACGGGCCCGCGGGTGAAGTCTTTAACAAGGCC
GCCGGGTTGGCTTCTGGCAAGATGGCAGAGGAGGTTATCTAG
Transcript >Hirsu2|1620
ATGGAGGTCGACGCAGAAGGAGAAGACATTGACGCTGAGGGTGAAGATGCCGAGGGAGAGGATGCTGAAGGCGAC
ATCGAGATGGATGCACCCACAGCCCCCACCGCTCCCACCATCAGGGTCTCCCAGCCTTCGACAGCTCGGTCAGCA
GCCAGGGCTGCCGCCTCCAAGATCGCCGCGGAGGAGGCCGACGACGACGACGACGACGACGACGACGACGACGAC
GACGACGACGACGACGATGCTGACGACGACGACGACGACGGTGATGAAGACGGCGACGGCGACGGCGATGACGAT
GGCGACGGCGACGATGACGATGAAGACGACGACGACCTCAGCGATCCTGGCGAAAGCGATACCGCCGGTGACCAA
ATGACAGGTATTAGAGATGAGGCCATGGTAGATGAGGATGCCGAGGGCGAGGAGATTGAGGTGGCAGGTGGGGAA
GATGCGGAAGAGGTCGAGCCGGATAGCGAAGATAATGGCAGCCAAGCTGAAACCCCGGACCTCACCAAAATGACA
AAACGCCAGCGTGCCCGCTTCAAGGACGAACCTCAGGAGTACATGAAGCTCTCAGACGAGGTTCAGGTCAAGAAG
CATTTCACCGCTGAAGAGCTGTCCATGCGCCGGCAAGAAATGGCCCGCCGCCGGCGCAACCTCAGCGAGAAGCGA
AACGAAGAAGTCAAGATGGAAACCATCAACAAGCTCCTGAAGAAGCAAGCACCCAAGATTAACCGTAAATCGGCG
GCGGGGGCAGCCCGAGGGGGTAGCCCGGATGAGGAGGAGCATAGGTCCAATCCCATCCTCATCCACTGGGTGAAT
AACAGAAATGGGAGTCGGCTGGCTGTACCCAATGATATTGTGTACGGGCCCGCGGGTGAAGTCTTTAACAAGGCC
GCCGGGTTGGCTTCTGGCAAGATGGCAGAGGAGGTTATCTAG
Gene >Hirsu2|1620
ATGGAGGTCGACGCAGAAGGAGAAGACATTGACGCTGAGGGTGAAGATGCCGAGGGAGAGGATGCTGAAGGCGAC
ATCGAGATGGATGCACCCACAGCCCCCACCGCTCCCACCATCAGGGTCTCCCAGCCTTCGACAGCTCGGTCAGCA
GCCAGGGCTGCCGCCTCCAAGATCGCCGCGGAGGAGGCCGACGACGACGACGACGACGACGACGACGACGACGAC
GACGACGACGACGACGATGCTGACGACGACGACGACGACGGTGATGAAGACGGCGACGGCGACGGCGATGACGAT
GGCGACGGCGACGATGACGATGAAGACGACGACGACCTCAGCGATCCTGGCGAAAGCGATACCGCCGGTGACCAA
ATGACAGGTATTAGAGATGAGGCCATGGTAGATGAGGATGCCGAGGGCGAGGAGATTGAGGTGGCAGGTGGGGAA
GATGCGGAAGAGGTCGAGCCGGATAGCGAAGATAATGGCAGCCAAGCTGAAACCCCGGACCTCACCAAAATGACA
AAACGCCAGCGTGCCCGCTTCAAGGACGAACCTCAGGAGTACATGAAGCTCTCAGACGGTACGTCGGTATAGTCC
ACGGCCGCACGGTGCAGATGCTCACGAAACCTATGCAGAGGTTCAGGTCAAGAAGCATTTCACCGCTGAAGAGCT
GTCCATGCGCCGGCAAGAAATGGCCCGCCGCCGGCGCAACCTCAGCGAGAAGCGAAACGAAGAAGTCAAGGTCAG
TTGGTATCTTCGGAACCCGCGAGCCGAAAAGCCTGCCCGCTTTGCCTGGCTTCAAAGCCAAGTATCGTGCCTAAC
ATATCACCCTAGATGGAAACCATCAACAAGCTCCTGAAGAAGCAAGCACCCAAGATTAACCGTAAATCGGCGGCG
GGGGCAGCCCGAGGGGGTAGCCCGGATGAGGAGGAGCATAGGTCCAATCCCATCCTCATCCACTGGGTGAATAAC
AGAAATGGGAGTCGGCTGGCTGTACCCAATGATATTGTGTACGGGCCCGCGGGTGAAGTCTTTAACAAGGCCGCC
GGGTTGGCTTCTGGCAAGATGGCAGAGGAGGTTATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail