Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|162
Gene name
LocationContig_1027:2417..4643
Strand+
Gene length (bp)2226
Transcript length (bp)2226
Coding sequence length (bp)2226
Protein length (aa) 742

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 1.9E-42 171 369
PF00271 Helicase_C Helicase conserved C-terminal domain 1.6E-19 475 557
PF13959 DUF4217 Domain of unknown function (DUF4217) 8.7E-17 625 684

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZ68|DBP7_GIBZE ATP-dependent RNA helicase DBP7 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP7 PE=3 SV=1 1 741 0.0E+00
sp|Q2GZU7|DBP7_CHAGB ATP-dependent RNA helicase DBP7 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP7 PE=3 SV=1 1 741 0.0E+00
sp|Q7S873|DBP7_NEUCR ATP-dependent RNA helicase dbp-7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-7 PE=3 SV=1 1 721 0.0E+00
sp|A4QX49|DBP7_MAGO7 ATP-dependent RNA helicase DBP7 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP7 PE=3 SV=1 1 741 0.0E+00
sp|Q1E9T9|DBP7_COCIM ATP-dependent RNA helicase DBP7 OS=Coccidioides immitis (strain RS) GN=DBP7 PE=3 SV=1 1 740 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZ68|DBP7_GIBZE ATP-dependent RNA helicase DBP7 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP7 PE=3 SV=1 1 741 0.0E+00
sp|Q2GZU7|DBP7_CHAGB ATP-dependent RNA helicase DBP7 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP7 PE=3 SV=1 1 741 0.0E+00
sp|Q7S873|DBP7_NEUCR ATP-dependent RNA helicase dbp-7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-7 PE=3 SV=1 1 721 0.0E+00
sp|A4QX49|DBP7_MAGO7 ATP-dependent RNA helicase DBP7 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP7 PE=3 SV=1 1 741 0.0E+00
sp|Q1E9T9|DBP7_COCIM ATP-dependent RNA helicase DBP7 OS=Coccidioides immitis (strain RS) GN=DBP7 PE=3 SV=1 1 740 0.0E+00
sp|A7F8V8|DBP7_SCLS1 ATP-dependent RNA helicase dbp7 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp7 PE=3 SV=1 102 741 0.0E+00
sp|A6RSH5|DBP7_BOTFB ATP-dependent RNA helicase dbp7 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp7 PE=3 SV=1 102 741 0.0E+00
sp|A1DE84|DBP7_NEOFI ATP-dependent RNA helicase dbp7 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp7 PE=3 SV=1 1 740 0.0E+00
sp|A1CB55|DBP7_ASPCL ATP-dependent RNA helicase dbp7 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp7 PE=3 SV=1 1 696 0.0E+00
sp|A2RA55|DBP7_ASPNC ATP-dependent RNA helicase dbp7 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp7 PE=3 SV=1 1 696 0.0E+00
sp|Q4WV71|DBP7_ASPFU ATP-dependent RNA helicase dbp7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp7 PE=3 SV=1 1 740 0.0E+00
sp|Q2UE66|DBP7_ASPOR ATP-dependent RNA helicase dbp7 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp7 PE=3 SV=1 1 741 0.0E+00
sp|Q5BGX6|DBP7_EMENI ATP-dependent RNA helicase dbp7 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp7 PE=3 SV=1 1 687 0.0E+00
sp|Q0CF43|DBP7_ASPTN ATP-dependent RNA helicase dbp7 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp7 PE=3 SV=2 1 696 0.0E+00
sp|Q0UHM7|DBP7_PHANO ATP-dependent RNA helicase DBP7 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP7 PE=3 SV=1 1 705 0.0E+00
sp|Q6C835|DBP7_YARLI ATP-dependent RNA helicase DBP7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP7 PE=3 SV=1 143 688 4.0E-160
sp|A3LWH3|DBP7_PICST ATP-dependent RNA helicase DBP7 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DPB7 PE=3 SV=2 3 739 7.0E-159
sp|A5DAR2|DBP7_PICGU ATP-dependent RNA helicase DBP7 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP7 PE=3 SV=3 1 739 2.0E-152
sp|Q59S50|DBP7_CANAL ATP-dependent RNA helicase DBP7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP7 PE=3 SV=1 3 739 5.0E-148
sp|O60173|DBP7_SCHPO ATP-dependent RNA helicase dbp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp7 PE=3 SV=1 1 741 2.0E-147
sp|Q6CK32|DBP7_KLULA ATP-dependent RNA helicase DBP7 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP7 PE=3 SV=1 3 741 1.0E-144
sp|Q6BKH3|DBP7_DEBHA ATP-dependent RNA helicase DBP7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP7 PE=3 SV=1 3 739 1.0E-142
sp|Q754J2|DBP7_ASHGO ATP-dependent RNA helicase DBP7 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP7 PE=3 SV=1 3 689 1.0E-142
sp|A7TNT1|DBP7_VANPO ATP-dependent RNA helicase DBP7 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP7 PE=3 SV=1 1 739 2.0E-140
sp|P36120|DBP7_YEAST ATP-dependent RNA helicase DBP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP7 PE=1 SV=1 3 739 1.0E-138
sp|A6ZZY8|DBP7_YEAS7 ATP-dependent RNA helicase DBP7 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP7 PE=3 SV=1 3 739 4.0E-138
sp|Q8TFL3|DBP7_CANGA ATP-dependent RNA helicase DBP7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP7 PE=3 SV=1 3 739 4.0E-134
sp|P0CQ94|DBP7_CRYNJ ATP-dependent RNA helicase DBP7 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP7 PE=3 SV=1 97 717 5.0E-104
sp|P0CQ95|DBP7_CRYNB ATP-dependent RNA helicase DBP7 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP7 PE=3 SV=1 97 717 5.0E-104
sp|Q7XJN0|RH17_ARATH DEAD-box ATP-dependent RNA helicase 17 OS=Arabidopsis thaliana GN=RH17 PE=2 SV=1 122 688 5.0E-100
sp|Q4P0Y5|DBP7_USTMA ATP-dependent RNA helicase DBP7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP7 PE=3 SV=1 139 689 5.0E-98
sp|Q0DLB9|RH17_ORYSJ DEAD-box ATP-dependent RNA helicase 17 OS=Oryza sativa subsp. japonica GN=Os05g0110500 PE=2 SV=2 153 688 6.0E-92
sp|Q6NZQ2|DDX31_MOUSE Probable ATP-dependent RNA helicase DDX31 OS=Mus musculus GN=Ddx31 PE=2 SV=2 68 708 8.0E-92
sp|Q9H8H2|DDX31_HUMAN Probable ATP-dependent RNA helicase DDX31 OS=Homo sapiens GN=DDX31 PE=1 SV=2 83 702 1.0E-89
sp|Q86B47|Y8611_DROME Probable ATP-dependent RNA helicase CG8611 OS=Drosophila melanogaster GN=CG8611 PE=1 SV=1 171 684 4.0E-86
sp|Q0UR48|HAS1_PHANO ATP-dependent RNA helicase HAS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HAS1 PE=3 SV=1 136 720 9.0E-71
sp|Q54S03|DDX18_DICDI Probable ATP-dependent RNA helicase ddx18 OS=Dictyostelium discoideum GN=ddx18 PE=3 SV=1 149 684 1.0E-67
sp|Q4P6N0|HAS1_USTMA ATP-dependent RNA helicase HAS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAS1 PE=3 SV=2 149 692 1.0E-66
sp|Q09916|HAS1_SCHPO ATP-dependent RNA helicase has1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=has1 PE=1 SV=1 144 685 2.0E-66
sp|P0CQ84|HAS1_CRYNJ ATP-dependent RNA helicase HAS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAS1 PE=3 SV=1 79 684 2.0E-66
sp|P0CQ85|HAS1_CRYNB ATP-dependent RNA helicase HAS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAS1 PE=3 SV=1 79 684 2.0E-66
sp|Q5BBY1|HAS1_EMENI ATP-dependent RNA helicase has1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=has1 PE=3 SV=1 136 720 4.0E-66
sp|Q6C7D2|HAS1_YARLI ATP-dependent RNA helicase HAS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HAS1 PE=3 SV=1 130 684 4.0E-66
sp|A1CIQ5|HAS1_ASPCL ATP-dependent RNA helicase has1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=has1 PE=3 SV=1 149 716 7.0E-66
sp|Q6CXB7|HAS1_KLULA ATP-dependent RNA helicase HAS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAS1 PE=3 SV=1 125 684 9.0E-66
sp|A1CW14|HAS1_NEOFI ATP-dependent RNA helicase has1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=has1 PE=3 SV=1 122 713 1.0E-65
sp|Q4WQM4|HAS1_ASPFU ATP-dependent RNA helicase has1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=has1 PE=3 SV=2 149 702 2.0E-65
sp|Q1EA54|HAS1_COCIM ATP-dependent RNA helicase HAS1 OS=Coccidioides immitis (strain RS) GN=HAS1 PE=3 SV=1 136 697 3.0E-65
sp|Q74Z73|HAS1_ASHGO ATP-dependent RNA helicase HAS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HAS1 PE=3 SV=2 149 707 3.0E-65
sp|A4R8B5|HAS1_MAGO7 ATP-dependent RNA helicase HAS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HAS1 PE=3 SV=2 149 698 7.0E-65
sp|Q4IEK8|HAS1_GIBZE ATP-dependent RNA helicase HAS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAS1 PE=3 SV=2 144 712 8.0E-65
sp|A5E2Z9|HAS1_LODEL ATP-dependent RNA helicase HAS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HAS1 PE=3 SV=1 131 702 3.0E-64
sp|Q9SB89|RH27_ARATH DEAD-box ATP-dependent RNA helicase 27 OS=Arabidopsis thaliana GN=RH27 PE=2 SV=2 149 684 4.0E-64
sp|Q6FIL3|HAS1_CANGA ATP-dependent RNA helicase HAS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAS1 PE=3 SV=1 148 684 4.0E-64
sp|Q03532|HAS1_YEAST ATP-dependent RNA helicase HAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAS1 PE=1 SV=1 121 684 6.0E-64
sp|Q7S2N9|HAS1_NEUCR ATP-dependent RNA helicase has-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=has-1 PE=3 SV=1 127 684 9.0E-64
sp|Q9LIH9|RH51_ARATH DEAD-box ATP-dependent RNA helicase 51 OS=Arabidopsis thaliana GN=RH51 PE=2 SV=1 149 700 1.0E-63
sp|Q2UUN6|HAS1_ASPOR ATP-dependent RNA helicase has1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=has1 PE=3 SV=2 144 703 2.0E-63
sp|Q5AK59|HAS1_CANAL ATP-dependent RNA helicase HAS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAS1 PE=3 SV=1 131 697 3.0E-63
sp|Q84T03|RH27_ORYSJ DEAD-box ATP-dependent RNA helicase 27 OS=Oryza sativa subsp. japonica GN=Os03g0802700 PE=3 SV=1 150 684 6.0E-63
sp|A2Q9T6|HAS1_ASPNC ATP-dependent RNA helicase has1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=has1 PE=3 SV=1 136 720 8.0E-63
sp|Q8K363|DDX18_MOUSE ATP-dependent RNA helicase DDX18 OS=Mus musculus GN=Ddx18 PE=1 SV=1 148 684 1.0E-62
sp|A3LNR6|HAS1_PICST ATP-dependent RNA helicase HAS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HAS1 PE=3 SV=2 103 697 3.0E-62
sp|Q6BH93|HAS1_DEBHA ATP-dependent RNA helicase HAS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HAS1 PE=3 SV=1 148 697 4.0E-62
sp|A5DID7|HAS1_PICGU ATP-dependent RNA helicase HAS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HAS1 PE=3 SV=2 149 697 2.0E-61
sp|Q9NVP1|DDX18_HUMAN ATP-dependent RNA helicase DDX18 OS=Homo sapiens GN=DDX18 PE=1 SV=2 141 684 7.0E-61
sp|Q9VD51|DDX18_DROME Probable ATP-dependent RNA helicase pitchoune OS=Drosophila melanogaster GN=pit PE=2 SV=2 144 684 1.0E-60
sp|Q2GMX1|HAS1_CHAGB ATP-dependent RNA helicase HAS1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HAS1 PE=3 SV=1 145 696 3.0E-60
sp|Q0DBS1|RH51_ORYSJ Putative DEAD-box ATP-dependent RNA helicase 51 OS=Oryza sativa subsp. japonica GN=Os06g0535100 PE=3 SV=2 149 703 2.0E-59
sp|Q869P0|DDX31_DICDI Probable ATP-dependent RNA helicase ddx31 OS=Dictyostelium discoideum GN=ddx31 PE=3 SV=2 148 452 2.0E-58
sp|Q0CZS8|HAS1_ASPTN ATP-dependent RNA helicase has1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=has1 PE=3 SV=1 149 705 2.0E-58
sp|Q1EB31|DBP4_COCIM ATP-dependent RNA helicase DBP4 OS=Coccidioides immitis (strain RS) GN=DBP4 PE=3 SV=1 142 684 9.0E-57
sp|A1CTZ2|DBP4_ASPCL ATP-dependent RNA helicase dbp4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp4 PE=3 SV=1 148 684 5.0E-56
sp|A1DNF9|DBP4_NEOFI ATP-dependent RNA helicase dbp4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp4 PE=3 SV=1 148 684 1.0E-55
sp|Q4WM60|DBP4_ASPFU ATP-dependent RNA helicase dbp4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp4 PE=3 SV=1 148 684 2.0E-55
sp|P0CQ82|DBP4_CRYNJ ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP4 PE=3 SV=1 142 701 2.0E-55
sp|P0CQ83|DBP4_CRYNB ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP4 PE=3 SV=1 142 701 2.0E-55
sp|A7ESL8|DBP4_SCLS1 ATP-dependent RNA helicase dbp4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp4 PE=3 SV=1 144 684 4.0E-55
sp|Q0UMB9|DBP4_PHANO ATP-dependent RNA helicase DBP4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP4 PE=3 SV=1 148 736 4.0E-55
sp|Q2UHB7|DBP4_ASPOR ATP-dependent RNA helicase dbp4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp4 PE=3 SV=1 148 684 1.0E-54
sp|Q5BFU1|DBP4_EMENI ATP-dependent RNA helicase dbp4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp4 PE=3 SV=1 144 684 4.0E-54
sp|Q0CMM5|DBP4_ASPTN ATP-dependent RNA helicase dbp4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp4 PE=3 SV=2 149 684 7.0E-54
sp|Q4P5U4|DBP4_USTMA ATP-dependent RNA helicase DBP4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP4 PE=3 SV=2 137 684 4.0E-53
sp|Q0UP45|SPB4_PHANO ATP-dependent rRNA helicase SPB4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SPB4 PE=3 SV=1 148 685 6.0E-53
sp|Q54Q94|DDX10_DICDI Probable ATP-dependent RNA helicase ddx10 OS=Dictyostelium discoideum GN=ddx10 PE=3 SV=1 147 685 1.0E-52
sp|A2QS00|DBP4_ASPNC ATP-dependent RNA helicase dbp4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp4 PE=3 SV=1 146 684 2.0E-52
sp|Q6CRF4|DBP4_KLULA ATP-dependent RNA helicase DBP4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP4 PE=3 SV=1 134 725 2.0E-52
sp|Q5AF95|DBP4_CANAL ATP-dependent RNA helicase DBP4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP4 PE=3 SV=1 144 698 4.0E-52
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 131 566 5.0E-52
sp|Q8JHJ2|DDX55_DANRE ATP-dependent RNA helicase DDX55 OS=Danio rerio GN=ddx55 PE=2 SV=2 149 684 1.0E-51
sp|Q4HVW2|SPB4_GIBZE ATP-dependent rRNA helicase SPB4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SPB4 PE=3 SV=1 154 684 1.0E-51
sp|A5DLF4|DBP4_PICGU ATP-dependent RNA helicase DBP4 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP4 PE=3 SV=2 146 704 2.0E-51
sp|A5E3K3|DBP4_LODEL ATP-dependent RNA helicase DBP4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP4 PE=3 SV=1 144 714 2.0E-51
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 129 566 3.0E-51
sp|P34580|DDX47_CAEEL Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans GN=T26G10.1 PE=3 SV=1 148 574 3.0E-51
sp|Q6CGD1|DBP4_YARLI ATP-dependent RNA helicase DBP4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP4 PE=3 SV=1 145 732 6.0E-51
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 120 566 2.0E-50
sp|Q75C76|DBP4_ASHGO ATP-dependent RNA helicase DBP4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP4 PE=3 SV=2 140 684 2.0E-50
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 127 563 2.0E-49
sp|Q9UTP9|DBP4_SCHPO ATP-dependent RNA helicase dbp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp4 PE=1 SV=1 146 580 2.0E-49
sp|A6RMZ2|SPB4_BOTFB ATP-dependent rRNA helicase spb4 OS=Botryotinia fuckeliana (strain B05.10) GN=spb4 PE=3 SV=1 153 656 2.0E-49
sp|Q6BXG0|DBP4_DEBHA ATP-dependent RNA helicase DBP4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP4 PE=3 SV=2 142 684 2.0E-49
sp|Q80Y44|DDX10_MOUSE Probable ATP-dependent RNA helicase DDX10 OS=Mus musculus GN=Ddx10 PE=1 SV=2 80 684 3.0E-49
sp|A3GGE9|DBP4_PICST ATP-dependent RNA helicase DBP4 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP4 PE=3 SV=2 146 581 5.0E-49
sp|Q873H9|SPB4_NEUCR ATP-dependent rRNA helicase spb-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spb-4 PE=3 SV=1 154 684 6.0E-49
sp|P38712|RRP3_YEAST ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP3 PE=1 SV=2 149 563 7.0E-49
sp|A6ZSX1|RRP3_YEAS7 ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRP3 PE=3 SV=1 149 563 1.0E-48
sp|Q2GV49|SPB4_CHAGB ATP-dependent rRNA helicase SPB4 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SPB4 PE=3 SV=1 148 684 1.0E-48
sp|Q7RZ35|DBP4_NEUCR ATP-dependent RNA helicase dbp-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-4 PE=3 SV=1 171 579 1.0E-48
sp|A7F2S3|SPB4_SCLS1 ATP-dependent rRNA helicase spb4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=spb4 PE=3 SV=1 153 656 2.0E-48
sp|Q6CT85|RRP3_KLULA ATP-dependent rRNA helicase RRP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRP3 PE=3 SV=1 152 563 2.0E-48
sp|A7TJ71|DBP4_VANPO ATP-dependent RNA helicase DBP4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP4 PE=3 SV=1 149 684 2.0E-48
sp|Q6C193|SPB4_YARLI ATP-dependent rRNA helicase SPB4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SPB4 PE=3 SV=1 148 684 3.0E-48
sp|Q5ZJF6|DDX10_CHICK Probable ATP-dependent RNA helicase DDX10 OS=Gallus gallus GN=DDX10 PE=2 SV=1 145 684 6.0E-48
sp|Q761Z9|RH18_ORYSJ DEAD-box ATP-dependent RNA helicase 18 OS=Oryza sativa subsp. japonica GN=Os01g0164500 PE=1 SV=2 154 684 7.0E-48
sp|Q9FLB0|RH18_ARATH DEAD-box ATP-dependent RNA helicase 18 OS=Arabidopsis thaliana GN=RH18 PE=2 SV=1 154 684 9.0E-48
sp|Q2NL08|DDX55_BOVIN ATP-dependent RNA helicase DDX55 OS=Bos taurus GN=DDX55 PE=2 SV=1 154 684 1.0E-47
sp|A4RGU2|DBP4_MAGO7 ATP-dependent RNA helicase DBP4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP4 PE=3 SV=1 149 736 1.0E-47
sp|A2QE29|SPB4_ASPNC ATP-dependent rRNA helicase spb4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=spb4 PE=3 SV=2 154 589 2.0E-47
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRP3 PE=3 SV=1 148 563 2.0E-47
sp|Q5ZLN8|DDX55_CHICK ATP-dependent RNA helicase DDX55 OS=Gallus gallus GN=DDX55 PE=2 SV=1 152 684 3.0E-47
sp|Q2H2J1|DBP4_CHAGB ATP-dependent RNA helicase DBP4 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP4 PE=3 SV=1 146 584 3.0E-47
sp|A6ZPU3|DBP4_YEAS7 ATP-dependent RNA helicase DBP4 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP4 PE=3 SV=1 136 702 3.0E-47
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 148 595 4.0E-47
sp|Q8GXD6|RH49_ARATH DEAD-box ATP-dependent RNA helicase 49 OS=Arabidopsis thaliana GN=RH49 PE=2 SV=2 154 684 4.0E-47
sp|P20448|DBP4_YEAST ATP-dependent RNA helicase HCA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCA4 PE=1 SV=2 136 702 4.0E-47
sp|Q4IAS1|DBP4_GIBZE ATP-dependent RNA helicase DBP4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP4 PE=3 SV=1 149 584 5.0E-47
sp|Q9VHU1|DDX55_DROME Probable ATP-dependent RNA helicase DDX55 homolog OS=Drosophila melanogaster GN=CG9630 PE=2 SV=1 154 684 2.0E-46
sp|Q54TJ4|DDX27_DICDI Probable ATP-dependent RNA helicase ddx27 OS=Dictyostelium discoideum GN=ddx27 PE=3 SV=1 149 566 2.0E-46
sp|Q13206|DDX10_HUMAN Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens GN=DDX10 PE=1 SV=2 145 684 2.0E-46
sp|Q4FZF3|DDX49_MOUSE Probable ATP-dependent RNA helicase DDX49 OS=Mus musculus GN=Ddx49 PE=2 SV=1 146 563 4.0E-46
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 146 579 6.0E-46
sp|Q6AZV7|DDX55_XENLA ATP-dependent RNA helicase DDX55 OS=Xenopus laevis GN=ddx55 PE=2 SV=1 162 684 9.0E-46
sp|Q0CIQ3|RRP3_ASPTN ATP-dependent rRNA helicase rrp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rrp3 PE=3 SV=2 136 566 1.0E-45
sp|A5DQF1|RRP3_PICGU ATP-dependent rRNA helicase RRP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRP3 PE=3 SV=2 121 586 1.0E-45
sp|Q2UNB7|RRP3_ASPOR ATP-dependent rRNA helicase rrp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrp3 PE=3 SV=1 127 577 1.0E-45
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 148 563 2.0E-45
sp|Q9Y6V7|DDX49_HUMAN Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens GN=DDX49 PE=1 SV=1 146 563 2.0E-45
sp|A5E2I8|SPB4_LODEL ATP-dependent rRNA helicase SPB4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SPB4 PE=3 SV=1 154 684 2.0E-45
sp|Q6FPT7|DBP4_CANGA ATP-dependent RNA helicase DBP4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP4 PE=3 SV=1 130 575 3.0E-45
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 124 593 4.0E-45
sp|Q59N29|SPB4_CANAL ATP-dependent rRNA helicase SPB41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPB4 PE=3 SV=1 154 684 4.0E-45
sp|Q59NP8|SPB42_CANAL ATP-dependent rRNA helicase SPB42 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPB42 PE=3 SV=1 171 684 5.0E-45
sp|A4RGD1|RRP3_MAGO7 ATP-dependent rRNA helicase RRP3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RRP3 PE=3 SV=1 126 627 6.0E-45
sp|A1D405|RRP3_NEOFI ATP-dependent rRNA helicase rrp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrp3 PE=3 SV=1 123 566 8.0E-45
sp|Q55BR9|DDX49_DICDI Probable ATP-dependent RNA helicase ddx49 OS=Dictyostelium discoideum GN=ddx49 PE=3 SV=1 149 568 8.0E-45
sp|Q4WJE9|RRP3_ASPFU ATP-dependent rRNA helicase rrp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrp3 PE=3 SV=1 129 566 1.0E-44
sp|A6QRQ7|RRP3_AJECN ATP-dependent rRNA helicase RRP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RRP3 PE=3 SV=1 123 563 1.0E-44
sp|Q0D622|RH32_ORYSJ DEAD-box ATP-dependent RNA helicase 32 OS=Oryza sativa subsp. japonica GN=Os07g0517000 PE=2 SV=2 146 587 1.0E-44
sp|A1CR32|RRP3_ASPCL ATP-dependent rRNA helicase rrp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rrp3 PE=3 SV=1 148 566 2.0E-44
sp|A2RB17|RRP3_ASPNC ATP-dependent rRNA helicase rrp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrp3 PE=3 SV=1 148 566 2.0E-44
sp|Q9FFT9|RH32_ARATH DEAD-box ATP-dependent RNA helicase 32 OS=Arabidopsis thaliana GN=RH32 PE=2 SV=1 144 584 3.0E-44
sp|Q0UK12|RRP3_PHANO ATP-dependent rRNA helicase RRP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRP3 PE=3 SV=2 149 566 3.0E-44
sp|Q4P3U9|RRP3_USTMA ATP-dependent rRNA helicase RRP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRP3 PE=3 SV=2 130 566 3.0E-44
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 144 563 4.0E-44
sp|Q5B5E7|RRP3_EMENI ATP-dependent rRNA helicase rrp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrp3 PE=3 SV=1 144 566 5.0E-44
sp|A6QXC1|DBP3_AJECN ATP-dependent RNA helicase DBP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP3 PE=3 SV=1 166 600 6.0E-44
sp|Q6FKS8|SPB4_CANGA ATP-dependent rRNA helicase SPB4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SPB4 PE=3 SV=1 171 699 6.0E-44
sp|O22907|RH24_ARATH DEAD-box ATP-dependent RNA helicase 24 OS=Arabidopsis thaliana GN=RH24 PE=1 SV=2 146 557 7.0E-44
sp|Q7ZY47|DDX42_XENLA ATP-dependent RNA helicase DDX42 OS=Xenopus laevis GN=ddx42 PE=2 SV=1 141 566 9.0E-44
sp|A7TJS7|SPB4_VANPO ATP-dependent rRNA helicase SPB4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SPB4 PE=3 SV=1 159 684 1.0E-43
sp|Q6ZPL9|DDX55_MOUSE ATP-dependent RNA helicase DDX55 OS=Mus musculus GN=Ddx55 PE=1 SV=2 154 684 1.0E-43
sp|Q8NHQ9|DDX55_HUMAN ATP-dependent RNA helicase DDX55 OS=Homo sapiens GN=DDX55 PE=1 SV=3 171 684 2.0E-43
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 149 577 2.0E-43
sp|Q810A7|DDX42_MOUSE ATP-dependent RNA helicase DDX42 OS=Mus musculus GN=Ddx42 PE=1 SV=3 100 568 2.0E-43
sp|Q86XP3|DDX42_HUMAN ATP-dependent RNA helicase DDX42 OS=Homo sapiens GN=DDX42 PE=1 SV=1 141 568 3.0E-43
sp|Q6CN92|SPB4_KLULA ATP-dependent rRNA helicase SPB4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SPB4 PE=3 SV=1 165 684 3.0E-43
sp|Q8SR63|RRP3_ENCCU ATP-dependent rRNA helicase RRP3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RRP3 PE=3 SV=1 149 563 3.0E-43
sp|Q5F485|DDX42_CHICK ATP-dependent RNA helicase DDX42 OS=Gallus gallus GN=DDX42 PE=2 SV=1 141 568 4.0E-43
sp|Q6BSM3|SPB4_DEBHA ATP-dependent rRNA helicase SPB4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SPB4 PE=3 SV=1 171 684 4.0E-43
sp|Q8L4E9|RH36_ORYSJ DEAD-box ATP-dependent RNA helicase 36 OS=Oryza sativa subsp. japonica GN=Os07g0633500 PE=3 SV=1 147 566 5.0E-43
sp|Q1E1N5|RRP3_COCIM ATP-dependent rRNA helicase RRP3 OS=Coccidioides immitis (strain RS) GN=RRP3 PE=3 SV=1 148 563 6.0E-43
sp|Q5R7D1|DDX42_PONAB ATP-dependent RNA helicase DDX42 OS=Pongo abelii GN=DDX42 PE=2 SV=1 141 568 6.0E-43
sp|A3LX02|SPB4_PICST ATP-dependent rRNA helicase SPB4 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SPB4 PE=3 SV=2 171 684 7.0E-43
sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 122 570 1.0E-42
sp|Q5ACK7|DRS1_CANAL ATP-dependent RNA helicase DRS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DRS1 PE=3 SV=1 132 575 1.0E-42
sp|Q5R4I9|DDX5_PONAB Probable ATP-dependent RNA helicase DDX5 OS=Pongo abelii GN=DDX5 PE=2 SV=1 122 570 1.0E-42
sp|Q4R6M5|DDX5_MACFA Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis GN=DDX5 PE=2 SV=1 122 570 1.0E-42
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 148 627 1.0E-42
sp|Q59W52|PRP28_CANAL Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP28 PE=3 SV=1 153 566 2.0E-42
sp|Q61656|DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus GN=Ddx5 PE=1 SV=2 146 570 2.0E-42
sp|Q9Y7T7|PRP28_SCHPO Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp28 PE=3 SV=1 148 590 2.0E-42
sp|Q9M2F9|RH52_ARATH DEAD-box ATP-dependent RNA helicase 52 OS=Arabidopsis thaliana GN=RH52 PE=1 SV=1 146 566 2.0E-42
sp|Q5Z6G5|RH35B_ORYSJ DEAD-box ATP-dependent RNA helicase 35B OS=Oryza sativa subsp. japonica GN=Os06g0697200 PE=3 SV=1 148 566 2.0E-42
sp|A5A6J2|DDX5_PANTR Probable ATP-dependent RNA helicase DDX5 OS=Pan troglodytes GN=DDX5 PE=2 SV=1 122 570 3.0E-42
sp|Q1E1R7|SPB4_COCIM ATP-dependent rRNA helicase SPB4 OS=Coccidioides immitis (strain RS) GN=SPB4 PE=3 SV=2 154 684 3.0E-42
sp|P25808|SPB4_YEAST ATP-dependent rRNA helicase SPB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPB4 PE=1 SV=1 162 684 4.0E-42
sp|A7A237|SPB4_YEAS7 ATP-dependent rRNA helicase SPB4 OS=Saccharomyces cerevisiae (strain YJM789) GN=SPB4 PE=3 SV=1 162 684 4.0E-42
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 147 586 4.0E-42
sp|Q9LU46|RH35_ARATH DEAD-box ATP-dependent RNA helicase 35 OS=Arabidopsis thaliana GN=RH35 PE=2 SV=1 146 566 5.0E-42
sp|Q6C9P3|DBP3_YARLI ATP-dependent RNA helicase DBP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP3 PE=3 SV=1 149 596 5.0E-42
sp|A1CL59|SPB4_ASPCL ATP-dependent rRNA helicase spb4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=spb4 PE=3 SV=1 154 684 5.0E-42
sp|Q9P6N8|RRP3_SCHPO ATP-dependent rRNA helicase rrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp3 PE=3 SV=1 149 563 7.0E-42
sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 146 580 8.0E-42
sp|Q6CJV1|DRS1_KLULA ATP-dependent RNA helicase DRS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DRS1 PE=3 SV=1 132 575 1.0E-41
sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=Arabidopsis thaliana GN=RH42 PE=1 SV=2 154 606 1.0E-41
sp|A1CHL3|PRP28_ASPCL Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp28 PE=3 SV=1 154 620 1.0E-41
sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=1 SV=1 146 579 2.0E-41
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 148 563 2.0E-41
sp|Q2UBZ5|SPB4_ASPOR ATP-dependent rRNA helicase spb4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=spb4 PE=3 SV=1 151 684 3.0E-41
sp|Q6BTL5|DRS1_DEBHA ATP-dependent RNA helicase DRS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DRS1 PE=3 SV=1 121 566 3.0E-41
sp|Q54EC2|DDX55_DICDI Probable ATP-dependent RNA helicase ddx55 OS=Dictyostelium discoideum GN=ddx55 PE=3 SV=1 154 684 3.0E-41
sp|Q5B8F4|SPB4_EMENI ATP-dependent rRNA helicase spb4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spb4 PE=3 SV=1 154 589 3.0E-41
sp|Q91VN6|DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus GN=Ddx41 PE=1 SV=2 146 580 3.0E-41
sp|A1CKJ0|DBP8_ASPCL ATP-dependent RNA helicase dbp8 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp8 PE=3 SV=1 145 566 3.0E-41
sp|Q2UKX3|DBP8_ASPOR ATP-dependent RNA helicase dbp8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp8 PE=3 SV=1 151 566 4.0E-41
sp|Q5B3H7|DBP8_EMENI ATP-dependent RNA helicase dbp8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp8 PE=3 SV=1 144 566 4.0E-41
sp|Q6FQZ0|DBP8_CANGA ATP-dependent RNA helicase DBP8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP8 PE=3 SV=1 148 566 5.0E-41
sp|Q8SR49|SPB4_ENCCU ATP-dependent rRNA helicase SPB4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SPB4 PE=3 SV=1 152 685 6.0E-41
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 146 586 6.0E-41
sp|A1D699|SPB4_NEOFI ATP-dependent rRNA helicase spb4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=spb4 PE=3 SV=1 154 684 7.0E-41
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 148 566 7.0E-41
sp|Q0CQF3|SPB4_ASPTN ATP-dependent rRNA helicase spb4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=spb4 PE=3 SV=1 151 589 7.0E-41
sp|Q4IFI0|RRP3_GIBZE ATP-dependent rRNA helicase RRP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRP3 PE=3 SV=1 148 577 7.0E-41
sp|Q869P0|DDX31_DICDI Probable ATP-dependent RNA helicase ddx31 OS=Dictyostelium discoideum GN=ddx31 PE=3 SV=2 488 711 8.0E-41
sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 146 579 8.0E-41
sp|A7TJM9|DRS1_VANPO ATP-dependent RNA helicase DRS1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DRS1 PE=3 SV=1 147 575 1.0E-40
sp|Q6BZ77|DBP3_DEBHA ATP-dependent RNA helicase DBP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP3 PE=3 SV=1 109 562 1.0E-40
sp|A3LP87|DBP8_PICST ATP-dependent RNA helicase DBP8 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP8 PE=3 SV=2 148 566 1.0E-40
sp|A1CX72|PRP28_NEOFI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp28 PE=3 SV=1 154 587 2.0E-40
sp|Q4WPE9|PRP28_ASPFU Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp28 PE=3 SV=1 154 586 2.0E-40
sp|Q6BGU8|DBP8_DEBHA ATP-dependent RNA helicase DBP8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP8 PE=3 SV=2 148 563 2.0E-40
sp|Q4IJH1|DBP3_GIBZE ATP-dependent RNA helicase DBP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP3 PE=3 SV=1 129 600 2.0E-40
sp|Q4WYJ7|SPB4_ASPFU ATP-dependent rRNA helicase spb4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spb4 PE=3 SV=2 154 684 2.0E-40
sp|A5AA68|DBP8_ASPNC ATP-dependent RNA helicase dbp8 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp8 PE=3 SV=1 143 566 2.0E-40
sp|Q0E3X4|RH35A_ORYSJ DEAD-box ATP-dependent RNA helicase 35A OS=Oryza sativa subsp. japonica GN=Os02g0150100 PE=2 SV=2 148 566 2.0E-40
sp|Q54VT4|DDX47_DICDI Probable ATP-dependent RNA helicase ddx47 OS=Dictyostelium discoideum GN=ddx47 PE=3 SV=1 149 593 3.0E-40
sp|A5E1W4|DBP3_LODEL ATP-dependent RNA helicase DBP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP3 PE=3 SV=2 146 596 3.0E-40
sp|A7TJ36|DBP3_VANPO ATP-dependent RNA helicase DBP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP3 PE=3 SV=1 149 562 3.0E-40
sp|Q6CXW0|DBP8_KLULA ATP-dependent RNA helicase DBP8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP8 PE=3 SV=1 147 566 4.0E-40
sp|A6RJA2|PRP28_BOTFB Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Botryotinia fuckeliana (strain B05.10) GN=prp28 PE=3 SV=1 148 566 4.0E-40
sp|Q10MH8|RH24_ORYSJ DEAD-box ATP-dependent RNA helicase 24 OS=Oryza sativa subsp. japonica GN=Os03g0308500 PE=2 SV=1 146 557 4.0E-40
sp|Q4WXW1|DBP8_ASPFU ATP-dependent RNA helicase dbp8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp8 PE=3 SV=1 145 566 4.0E-40
sp|A5DU73|PRP28_LODEL Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRP28 PE=3 SV=1 154 579 4.0E-40
sp|A7EGG4|PRP28_SCLS1 Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp28 PE=3 SV=1 154 586 4.0E-40
sp|Q5RC67|DDX23_PONAB Probable ATP-dependent RNA helicase DDX23 OS=Pongo abelii GN=DDX23 PE=2 SV=1 146 586 4.0E-40
sp|Q4I830|DRS1_GIBZE ATP-dependent RNA helicase DRS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DRS1 PE=3 SV=1 133 563 4.0E-40
sp|Q54IV3|DDX42_DICDI Probable ATP-dependent RNA helicase ddx42 OS=Dictyostelium discoideum GN=ddx42 PE=3 SV=1 146 585 5.0E-40
sp|Q7Y183|RH10_ORYSJ DEAD-box ATP-dependent RNA helicase 10 OS=Oryza sativa subsp. japonica GN=Os03g0669000 PE=2 SV=1 147 563 5.0E-40
sp|Q1DHB2|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1 146 580 6.0E-40
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 137 566 6.0E-40
sp|A7TK63|DBP8_VANPO ATP-dependent RNA helicase DBP8 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP8 PE=3 SV=1 148 568 6.0E-40
sp|Q4I662|DBP8_GIBZE ATP-dependent RNA helicase DBP8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP8 PE=3 SV=1 134 566 7.0E-40
sp|Q553B1|DDX46_DICDI ATP-dependent RNA helicase ddx46 OS=Dictyostelium discoideum GN=helB1 PE=2 SV=1 162 586 7.0E-40
sp|P32892|DRS1_YEAST ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS1 PE=1 SV=2 148 575 7.0E-40
sp|A7A0P8|DRS1_YEAS7 ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DRS1 PE=3 SV=1 148 575 7.0E-40
sp|Q2R1M8|RH52C_ORYSJ DEAD-box ATP-dependent RNA helicase 52C OS=Oryza sativa subsp. japonica GN=Os11g0599500 PE=3 SV=1 146 566 9.0E-40
sp|Q750F8|SPB4_ASHGO ATP-dependent rRNA helicase SPB4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SPB4 PE=3 SV=2 159 685 9.0E-40
sp|P0CQ88|PRP28_CRYNJ Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP28 PE=3 SV=1 148 577 9.0E-40
sp|P0CQ89|PRP28_CRYNB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP28 PE=3 SV=1 148 577 9.0E-40
sp|Q2UH00|PRP28_ASPOR Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp28 PE=3 SV=1 154 586 1.0E-39
sp|Q0CLX0|PRP28_ASPTN Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp28 PE=3 SV=1 154 586 1.0E-39
sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana GN=RH3 PE=1 SV=2 152 565 1.0E-39
sp|Q10202|DBP3_SCHPO ATP-dependent RNA helicase dbp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp3 PE=3 SV=1 143 568 1.0E-39
sp|A5DKW3|DRS1_PICGU ATP-dependent RNA helicase DRS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DRS1 PE=3 SV=2 146 566 1.0E-39
sp|Q6C024|PRP28_YARLI Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP28 PE=3 SV=1 160 577 1.0E-39
sp|Q5BCU6|PRP28_EMENI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp28 PE=3 SV=2 154 586 2.0E-39
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 148 563 2.0E-39
sp|Q84W89|RH37_ARATH DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana GN=RH37 PE=2 SV=2 146 570 2.0E-39
sp|A5DGM4|SPB4_PICGU ATP-dependent rRNA helicase SPB4 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SPB4 PE=3 SV=2 159 684 2.0E-39
sp|A6R918|SPB4_AJECN ATP-dependent rRNA helicase SPB4 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SPB4 PE=3 SV=2 154 684 2.0E-39
sp|Q1E0Z3|DBP8_COCIM ATP-dependent RNA helicase DBP8 OS=Coccidioides immitis (strain RS) GN=DBP8 PE=3 SV=1 45 566 2.0E-39
sp|Q6BLU9|PRP28_DEBHA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP28 PE=3 SV=2 154 577 2.0E-39
sp|A5DLE0|DBP8_PICGU ATP-dependent RNA helicase DBP8 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP8 PE=3 SV=2 148 563 2.0E-39
sp|Q0INC5|RH28_ORYSJ DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sativa subsp. japonica GN=Os12g0481100 PE=2 SV=2 148 566 2.0E-39
sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 137 578 2.0E-39
sp|Q9SZB4|RH43_ARATH Putative DEAD-box ATP-dependent RNA helicase 43 OS=Arabidopsis thaliana GN=RH43 PE=3 SV=1 146 566 3.0E-39
sp|Q8LA13|RH11_ARATH DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana GN=RH11 PE=1 SV=1 146 566 3.0E-39
sp|Q5APT8|DBP3_CANAL ATP-dependent RNA helicase DBP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP3 PE=3 SV=1 129 596 3.0E-39
sp|Q7S5R1|DBP3_NEUCR ATP-dependent RNA helicase dbp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-3 PE=3 SV=1 130 600 3.0E-39
sp|A1D6X9|DBP8_NEOFI ATP-dependent RNA helicase dbp8 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp8 PE=3 SV=1 145 566 3.0E-39
sp|O13370|DED1_SCHPO ATP-dependent RNA helicase ded1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ded1 PE=1 SV=1 146 586 3.0E-39
sp|Q9SA27|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36 OS=Arabidopsis thaliana GN=RH36 PE=2 SV=1 131 563 3.0E-39
sp|Q755N4|DBP2_ASHGO ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP2 PE=3 SV=2 146 566 4.0E-39
sp|Q0D1K3|PRP5_ASPTN Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp5 PE=3 SV=1 146 597 4.0E-39
sp|Q6K7R9|RH48_ORYSJ DEAD-box ATP-dependent RNA helicase 48 OS=Oryza sativa subsp. japonica GN=Os02g0826100 PE=2 SV=1 149 618 4.0E-39
sp|A6SFV4|DBP8_BOTFB ATP-dependent RNA helicase dbp8 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp8 PE=3 SV=1 138 566 4.0E-39
sp|Q75F95|DRS1_ASHGO ATP-dependent RNA helicase DRS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRS1 PE=3 SV=1 128 575 4.0E-39
sp|Q6CB69|DED1_YARLI ATP-dependent RNA helicase DED1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DED1 PE=3 SV=1 149 594 4.0E-39
sp|A7E436|DBP8_SCLS1 ATP-dependent RNA helicase dbp8 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp8 PE=3 SV=1 138 566 5.0E-39
sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2 152 566 5.0E-39
sp|Q4I7F9|PRP28_GIBZE Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP28 PE=3 SV=1 153 590 6.0E-39
sp|Q59PR3|DBP8_CANAL ATP-dependent RNA helicase DBP8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP8 PE=3 SV=1 148 563 6.0E-39
sp|P0CQ76|DBP2_CRYNJ ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP2 PE=3 SV=1 122 579 6.0E-39
sp|P0CQ77|DBP2_CRYNB ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP2 PE=3 SV=1 122 579 6.0E-39
sp|Q2HAD8|PRP5_CHAGB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP5 PE=3 SV=1 146 586 7.0E-39
sp|A5E0U9|DBP8_LODEL ATP-dependent RNA helicase DBP8 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP8 PE=3 SV=1 148 563 8.0E-39
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 149 579 9.0E-39
sp|Q6CIV2|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1 146 579 9.0E-39
sp|A1DG51|DBP3_NEOFI ATP-dependent RNA helicase dbp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp3 PE=3 SV=1 142 600 1.0E-38
sp|Q4WH83|DBP3_ASPFU ATP-dependent RNA helicase dbp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp3 PE=3 SV=1 142 600 1.0E-38
sp|Q8SRB2|DBP2_ENCCU ATP-dependent RNA helicase DBP2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP2 PE=3 SV=1 113 579 1.0E-38
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 137 566 1.0E-38
sp|Q4WT99|PRP5_ASPFU Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp5 PE=3 SV=1 146 597 1.0E-38
sp|Q6FM43|PRP28_CANGA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP28 PE=3 SV=1 165 566 2.0E-38
sp|Q7SEL0|PRP28_NEUCR Pre-mRNA-splicing ATP-dependent RNA helicase prp-28 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-28 PE=3 SV=1 153 590 2.0E-38
sp|Q7SH33|PRP5_NEUCR Pre-mRNA-processing ATP-dependent RNA helicase prp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-5 PE=3 SV=1 146 586 2.0E-38
sp|O80792|RH33_ARATH Putative DEAD-box ATP-dependent RNA helicase 33 OS=Arabidopsis thaliana GN=RH33 PE=3 SV=1 187 618 2.0E-38
sp|P0CR02|DBP8_CRYNJ ATP-dependent RNA helicase DBP8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP8 PE=3 SV=1 142 566 2.0E-38
sp|Q2U2J6|PRP5_ASPOR Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp5 PE=3 SV=1 146 597 2.0E-38
sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 154 580 2.0E-38
sp|A4QYM6|DRS1_MAGO7 ATP-dependent RNA helicase DRS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DRS1 PE=3 SV=1 138 563 2.0E-38
sp|Q9C8S9|RH48_ARATH Probable DEAD-box ATP-dependent RNA helicase 48 OS=Arabidopsis thaliana GN=RH48 PE=3 SV=1 187 618 3.0E-38
sp|A2QQA8|PRP5_ASPNC Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp5 PE=3 SV=2 146 593 3.0E-38
sp|Q6Z4K6|RH52B_ORYSJ DEAD-box ATP-dependent RNA helicase 52B OS=Oryza sativa subsp. japonica GN=PL10B PE=2 SV=1 149 566 3.0E-38
sp|P0CR03|DBP8_CRYNB ATP-dependent RNA helicase DBP8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP8 PE=3 SV=1 142 566 3.0E-38
sp|Q0CNX1|DBP8_ASPTN ATP-dependent RNA helicase dbp8 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp8 PE=3 SV=1 147 566 3.0E-38
sp|Q75HJ0|RH37_ORYSJ DEAD-box ATP-dependent RNA helicase 37 OS=Oryza sativa subsp. japonica GN=PL10A PE=2 SV=1 146 570 3.0E-38
sp|A5DL80|DBP2_PICGU ATP-dependent RNA helicase DBP2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP2 PE=3 SV=3 146 573 3.0E-38
sp|Q1DMX8|PRP28_COCIM Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Coccidioides immitis (strain RS) GN=PRP28 PE=3 SV=2 148 586 4.0E-38
sp|P38719|DBP8_YEAST ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP8 PE=1 SV=1 146 566 4.0E-38
sp|A6ZT77|DBP8_YEAS7 ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP8 PE=3 SV=1 146 566 4.0E-38
sp|Q6FS54|DBP3_CANGA ATP-dependent RNA helicase DBP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP3 PE=3 SV=1 130 600 4.0E-38
sp|Q5ADL0|PRP5_CANAL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP5 PE=3 SV=1 164 580 4.0E-38
sp|Q756G5|DBP8_ASHGO ATP-dependent RNA helicase DBP8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP8 PE=3 SV=1 147 568 4.0E-38
sp|A1D373|PRP5_NEOFI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp5 PE=3 SV=1 146 597 4.0E-38
sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1 137 566 5.0E-38
sp|Q2GUI4|DBP3_CHAGB ATP-dependent RNA helicase DBP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP3 PE=3 SV=1 170 566 5.0E-38
sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 137 566 5.0E-38
sp|Q9ZRZ8|RH28_ARATH DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana GN=RH28 PE=2 SV=1 148 566 5.0E-38
sp|A1C5V3|DBP3_ASPCL ATP-dependent RNA helicase dbp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp3 PE=3 SV=1 170 600 5.0E-38
sp|Q61R02|DDX55_CAEBR Probable ATP-dependent RNA helicase DDX55 homolog OS=Caenorhabditis briggsae GN=CBG06798 PE=3 SV=1 171 684 6.0E-38
sp|A6ZUA1|DBP3_YEAS7 ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP3 PE=3 SV=1 107 600 6.0E-38
sp|Q54KG1|DDX41_DICDI Probable ATP-dependent RNA helicase ddx41 OS=Dictyostelium discoideum GN=ddx41 PE=1 SV=1 146 566 6.0E-38
sp|Q09903|DRS1_SCHPO ATP-dependent RNA helicase drs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=drs1 PE=3 SV=1 147 583 9.0E-38
sp|Q6BML1|PRP5_DEBHA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP5 PE=3 SV=2 163 566 9.0E-38
sp|P20447|DBP3_YEAST ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP3 PE=1 SV=2 107 600 9.0E-38
sp|Q7RYZ7|DBP8_NEUCR ATP-dependent RNA helicase dbp-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-8 PE=3 SV=1 87 566 9.0E-38
sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1 146 566 1.0E-37
sp|Q6CLR3|DED1_KLULA ATP-dependent RNA helicase DED1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DED1 PE=3 SV=1 146 578 1.0E-37
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 135 566 1.0E-37
sp|A2QIL2|PRP28_ASPNC Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp28 PE=3 SV=1 153 587 1.0E-37
sp|A7EYW0|DBP3_SCLS1 ATP-dependent RNA helicase dbp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp3 PE=3 SV=2 166 600 1.0E-37
sp|Q755A5|DBP3_ASHGO ATP-dependent RNA helicase DBP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP3 PE=3 SV=1 101 600 1.0E-37
sp|Q6C799|DBP8_YARLI ATP-dependent RNA helicase DBP8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP8 PE=3 SV=1 148 563 2.0E-37
sp|A3LSN3|DRS1_PICST ATP-dependent RNA helicase DRS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DRS1 PE=3 SV=3 125 566 2.0E-37
sp|Q76PD3|DBP6_SCHPO ATP-dependent RNA helicase dbp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp6 PE=2 SV=1 121 574 2.0E-37
sp|P0C2N8|DRS1_NEUCR ATP-dependent RNA helicase drs1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-11 PE=3 SV=1 131 563 2.0E-37
sp|Q4IP34|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2 146 586 2.0E-37
sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 146 566 2.0E-37
sp|Q0DB53|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A OS=Oryza sativa subsp. japonica GN=Os06g0602400 PE=2 SV=2 142 586 2.0E-37
sp|Q5JKF2|RH40_ORYSJ DEAD-box ATP-dependent RNA helicase 40 OS=Oryza sativa subsp. japonica GN=Os01g0549400 PE=2 SV=2 140 579 2.0E-37
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 146 566 3.0E-37
sp|Q5AWA6|DBP3_EMENI ATP-dependent RNA helicase dbp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp3 PE=3 SV=2 49 600 3.0E-37
sp|Q5BDW4|PRP5_EMENI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp5 PE=3 SV=1 146 580 3.0E-37
sp|Q53RK8|RH21_ORYSJ DEAD-box ATP-dependent RNA helicase 21 OS=Oryza sativa subsp. japonica GN=Os03g0708600 PE=2 SV=1 154 586 3.0E-37
sp|Q6CT49|PRP28_KLULA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP28 PE=3 SV=1 165 566 4.0E-37
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 146 591 4.0E-37
sp|A1CQA9|PRP5_ASPCL Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp5 PE=3 SV=1 146 597 4.0E-37
sp|Q8SR01|DBP4_ENCCU ATP-dependent RNA helicase DBP4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP4 PE=3 SV=2 149 572 4.0E-37
sp|Q8TFK8|DED1_CANGA ATP-dependent RNA helicase DED1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DED1 PE=3 SV=1 146 594 4.0E-37
sp|P19109|DDX17_DROME ATP-dependent RNA helicase p62 OS=Drosophila melanogaster GN=Rm62 PE=1 SV=3 121 566 5.0E-37
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 146 582 5.0E-37
sp|Q9HGM5|DBP8_SCHPO ATP-dependent RNA helicase dbp8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp8 PE=3 SV=1 148 563 5.0E-37
sp|P34640|DDX55_CAEEL Probable ATP-dependent RNA helicase DDX55 homolog OS=Caenorhabditis elegans GN=ZK512.2 PE=3 SV=2 171 684 6.0E-37
sp|A7TKR8|DED1_VANPO ATP-dependent RNA helicase DED1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DED1 PE=3 SV=1 138 594 6.0E-37
sp|Q9P7C7|PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp11 PE=3 SV=1 146 590 7.0E-37
sp|A6SCT6|DBP3_BOTFB ATP-dependent RNA helicase dbp3 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp3 PE=3 SV=1 134 600 8.0E-37
sp|A4QSS5|DBP2_MAGO7 ATP-dependent RNA helicase DBP2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP2 PE=3 SV=1 135 566 9.0E-37
sp|A3LRW2|DBP3_PICST ATP-dependent RNA helicase DBP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP3 PE=3 SV=1 128 596 9.0E-37
sp|Q0U8V9|DBP8_PHANO ATP-dependent RNA helicase DBP8 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP8 PE=3 SV=1 85 566 9.0E-37
sp|A6RUH2|DRS1_BOTFB ATP-dependent RNA helicase drs1 OS=Botryotinia fuckeliana (strain B05.10) GN=drs1 PE=3 SV=1 149 563 1.0E-36
sp|Q0V1Z7|DRS1_PHANO ATP-dependent RNA helicase DRS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DRS1 PE=3 SV=1 146 563 1.0E-36
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 146 566 1.0E-36
sp|A4RK80|PRP28_MAGO7 Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP28 PE=3 SV=1 158 587 1.0E-36
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 154 586 1.0E-36
sp|Q2HEB0|PRP28_CHAGB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP28 PE=3 SV=1 153 590 1.0E-36
sp|Q0UN57|PRP5_PHANO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PRP5 PE=3 SV=2 146 580 1.0E-36
sp|Q0UWC8|PRP28_PHANO Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PRP28 PE=3 SV=1 157 565 2.0E-36
sp|P24783|DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP2 PE=1 SV=1 146 566 2.0E-36
sp|A6ZRX0|DBP2_YEAS7 ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP2 PE=3 SV=1 146 566 2.0E-36
sp|Q9FNM7|RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana GN=RH26 PE=1 SV=2 171 588 2.0E-36
sp|A4RN46|PRP5_MAGO7 Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP5 PE=3 SV=1 154 586 2.0E-36
sp|A3LNL1|PRP28_PICST Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PRP28 PE=3 SV=2 154 579 2.0E-36
sp|A7F4L5|DRS1_SCLS1 ATP-dependent RNA helicase drs1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=drs1 PE=3 SV=1 147 563 3.0E-36
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 146 582 3.0E-36
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 146 582 3.0E-36
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 146 582 3.0E-36
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 146 582 3.0E-36
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 146 582 3.0E-36
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 146 582 3.0E-36
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 146 582 3.0E-36
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 146 582 3.0E-36
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 146 575 3.0E-36
sp|Q54CE0|DDX17_DICDI Probable ATP-dependent RNA helicase ddx17 OS=Dictyostelium discoideum GN=ddx17 PE=3 SV=1 146 579 3.0E-36
sp|Q54QS3|DDX3_DICDI Probable ATP-dependent RNA helicase ddx3 OS=Dictyostelium discoideum GN=ddx3 PE=3 SV=1 143 600 3.0E-36
sp|P06634|DED1_YEAST ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED1 PE=1 SV=2 146 599 3.0E-36
sp|A6ZP47|DED1_YEAS7 ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DED1 PE=3 SV=1 146 599 3.0E-36
sp|Q2H720|DBP2_CHAGB ATP-dependent RNA helicase DBP2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP2 PE=3 SV=1 138 566 3.0E-36
sp|Q49Z29|CSHA_STAS1 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cshA PE=3 SV=1 146 582 4.0E-36
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 147 568 4.0E-36
sp|Q4PFD9|PRP5_USTMA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PRP5 PE=3 SV=1 142 592 4.0E-36
sp|A3LQ55|PRP5_PICST Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PRP5 PE=3 SV=2 164 592 4.0E-36
sp|A2QFL3|DBP3_ASPNC ATP-dependent RNA helicase dbp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp3 PE=3 SV=1 80 600 4.0E-36
sp|Q5ZBH5|RH25_ORYSJ DEAD-box ATP-dependent RNA helicase 25 OS=Oryza sativa subsp. japonica GN=Os01g0618400 PE=2 SV=1 149 568 4.0E-36
sp|Q9SQV1|RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana GN=RH40 PE=2 SV=1 123 566 4.0E-36
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 148 563 6.0E-36
sp|Q5W5U4|DDX4_BOVIN Probable ATP-dependent RNA helicase DDX4 OS=Bos taurus GN=DDX4 PE=2 SV=1 142 566 6.0E-36
sp|Q9FFQ1|RH31_ARATH DEAD-box ATP-dependent RNA helicase 31 OS=Arabidopsis thaliana GN=RH31 PE=2 SV=2 171 588 6.0E-36
sp|Q61496|DDX4_MOUSE Probable ATP-dependent RNA helicase DDX4 OS=Mus musculus GN=Ddx4 PE=1 SV=2 140 566 7.0E-36
sp|Q6GWX0|DDX4_PIG Probable ATP-dependent RNA helicase DDX4 OS=Sus scrofa GN=DDX4 PE=2 SV=1 140 566 7.0E-36
sp|Q5A4E2|DED1_CANAL ATP-dependent RNA helicase DED1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DED1 PE=3 SV=1 146 601 7.0E-36
sp|Q9LYJ9|RH46_ARATH DEAD-box ATP-dependent RNA helicase 46 OS=Arabidopsis thaliana GN=RH46 PE=2 SV=2 148 566 7.0E-36
sp|Q62167|DDX3X_MOUSE ATP-dependent RNA helicase DDX3X OS=Mus musculus GN=Ddx3x PE=1 SV=3 28 566 8.0E-36
sp|Q4TVV3|DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio GN=ddx46 PE=2 SV=1 113 590 8.0E-36
sp|Q6FLF3|DBP2_CANGA ATP-dependent RNA helicase DBP2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP2 PE=3 SV=1 146 566 8.0E-36
sp|O13622|MS116_SCHPO ATP-dependent RNA helicase mss116, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mss116 PE=3 SV=1 133 567 8.0E-36
sp|Q9V3C0|DDX41_DROME ATP-dependent RNA helicase abstrakt OS=Drosophila melanogaster GN=abs PE=1 SV=1 118 579 8.0E-36
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 146 575 9.0E-36
sp|Q0CL13|DBP3_ASPTN ATP-dependent RNA helicase dbp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp3 PE=3 SV=1 134 596 9.0E-36
sp|P0CR08|SPB4_CRYNJ ATP-dependent rRNA helicase SPB4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SPB4 PE=3 SV=1 140 685 9.0E-36
sp|P0CR09|SPB4_CRYNB ATP-dependent rRNA helicase SPB4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SPB4 PE=3 SV=1 140 685 9.0E-36
sp|Q0UY62|DBP3_PHANO ATP-dependent RNA helicase DBP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP3 PE=3 SV=1 170 600 1.0E-35
sp|P0CQ98|PRP5_CRYNJ Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP5 PE=3 SV=1 146 580 1.0E-35
sp|P0CQ99|PRP5_CRYNB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP5 PE=3 SV=1 146 580 1.0E-35
sp|A5DF03|PRP28_PICGU Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PRP28 PE=3 SV=2 154 577 1.0E-35
sp|Q94C75|RH25_ARATH DEAD-box ATP-dependent RNA helicase 25 OS=Arabidopsis thaliana GN=RH25 PE=2 SV=2 120 595 1.0E-35
sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1 89 566 1.0E-35
sp|Q6GVM6|DDX3Y_PANTR ATP-dependent RNA helicase DDX3Y OS=Pan troglodytes GN=DDX3Y PE=2 SV=1 55 566 2.0E-35
sp|Q4R5S7|DDX4_MACFA Probable ATP-dependent RNA helicase DDX4 OS=Macaca fascicularis GN=DDX4 PE=2 SV=1 140 566 2.0E-35
sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 137 566 2.0E-35
sp|Q9NQI0|DDX4_HUMAN Probable ATP-dependent RNA helicase DDX4 OS=Homo sapiens GN=DDX4 PE=1 SV=2 140 566 2.0E-35
sp|P46942|DB10_NICSY ATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris PE=2 SV=1 144 579 2.0E-35
sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 146 570 2.0E-35
sp|Q6CCZ1|PRP5_YARLI Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP5 PE=3 SV=1 146 590 2.0E-35
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 146 582 3.0E-35
sp|Q0D8N0|RH53_ORYSJ DEAD-box ATP-dependent RNA helicase 53 OS=Oryza sativa subsp. japonica GN=Os07g0143700 PE=2 SV=2 93 565 3.0E-35
sp|Q0DBU5|RH31_ORYSJ DEAD-box ATP-dependent RNA helicase 31 OS=Oryza sativa subsp. japonica GN=Os06g0526600 PE=3 SV=2 149 571 3.0E-35
sp|A6ZSB3|DBP6_YEAS7 ATP-dependent RNA helicase DBP6 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP6 PE=3 SV=1 187 576 3.0E-35
sp|P24346|DDX3_XENLA Putative ATP-dependent RNA helicase an3 OS=Xenopus laevis GN=an3 PE=2 SV=1 54 566 3.0E-35
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 146 582 4.0E-35
sp|Q81DF9|CSHE_BACCR DEAD-box ATP-dependent RNA helicase CshE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshE PE=2 SV=1 146 584 4.0E-35
sp|Q2HBE7|DED1_CHAGB ATP-dependent RNA helicase DED1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DED1 PE=3 SV=1 146 594 4.0E-35
sp|A7ENE0|PRP5_SCLS1 Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp5 PE=3 SV=1 146 580 4.0E-35
sp|P15424|MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSS116 PE=1 SV=1 171 566 4.0E-35
sp|Q64060|DDX4_RAT Probable ATP-dependent RNA helicase DDX4 OS=Rattus norvegicus GN=Ddx4 PE=1 SV=1 140 566 5.0E-35
sp|Q4P733|DED1_USTMA ATP-dependent RNA helicase DED1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DED1 PE=3 SV=1 146 598 5.0E-35
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1 80 579 5.0E-35
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 146 582 5.0E-35
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 146 582 5.0E-35
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 146 582 5.0E-35
sp|O49289|RH29_ARATH Putative DEAD-box ATP-dependent RNA helicase 29 OS=Arabidopsis thaliana GN=RH29 PE=3 SV=1 149 595 5.0E-35
sp|A6RW79|PRP5_BOTFB Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Botryotinia fuckeliana (strain B05.10) GN=prp5 PE=3 SV=1 146 580 6.0E-35
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 141 568 6.0E-35
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 141 568 6.0E-35
sp|Q0UG00|MS116_PHANO ATP-dependent RNA helicase MSS116, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MSS116 PE=3 SV=1 138 595 6.0E-35
sp|A7TJK8|PRP5_VANPO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=PRP5 PE=3 SV=1 146 568 6.0E-35
sp|Q4P9E5|SPB4_USTMA ATP-dependent rRNA helicase SPB4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SPB4 PE=3 SV=2 278 685 6.0E-35
sp|O00571|DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 28 566 6.0E-35
sp|Q5RF43|DDX3Y_PONAB ATP-dependent RNA helicase DDX3Y OS=Pongo abelii GN=DDX3Y PE=2 SV=1 55 566 6.0E-35
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 146 582 7.0E-35
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 146 582 7.0E-35
sp|A5E6W6|RRP3_LODEL ATP-dependent rRNA helicase RRP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RRP3 PE=3 SV=1 146 592 7.0E-35
sp|Q2UST1|MS116_ASPOR ATP-dependent RNA helicase mss116, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mss116 PE=3 SV=1 154 566 7.0E-35
sp|C8V8H4|DED1_EMENI ATP-dependent RNA helicase ded1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ded1 PE=3 SV=1 146 592 8.0E-35
sp|A1CXK7|DED1_NEOFI ATP-dependent RNA helicase ded1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ded1 PE=3 SV=1 146 592 8.0E-35
sp|A4RHF1|DED1_MAGO7 ATP-dependent RNA helicase DED1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DED1 PE=3 SV=2 146 566 8.0E-35
sp|Q6BY27|DBP2_DEBHA ATP-dependent RNA helicase DBP2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP2 PE=3 SV=1 146 566 9.0E-35
sp|Q1E2B2|DRS1_COCIM ATP-dependent RNA helicase DRS1 OS=Coccidioides immitis (strain RS) GN=DRS1 PE=3 SV=1 147 643 1.0E-34
sp|A1CH78|DED1_ASPCL ATP-dependent RNA helicase ded1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ded1 PE=3 SV=1 146 592 1.0E-34
sp|A5DAC8|DBP3_PICGU ATP-dependent RNA helicase DBP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP3 PE=3 SV=2 146 562 1.0E-34
sp|P24782|DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp2 PE=2 SV=2 122 566 1.0E-34
sp|Q4IF76|DBP2_GIBZE ATP-dependent RNA helicase DBP2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP2 PE=3 SV=1 138 566 1.0E-34
sp|Q6P9R1|DDX51_MOUSE ATP-dependent RNA helicase DDX51 OS=Mus musculus GN=Ddx51 PE=1 SV=1 47 584 1.0E-34
sp|Q89AF9|DEAD_BUCBP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=deaD PE=3 SV=1 149 566 1.0E-34
sp|Q8K4L0|DDX54_MOUSE ATP-dependent RNA helicase DDX54 OS=Mus musculus GN=Ddx54 PE=1 SV=1 116 568 1.0E-34
sp|Q1DJF0|DED1_COCIM ATP-dependent RNA helicase DED1 OS=Coccidioides immitis (strain RS) GN=DED1 PE=3 SV=2 146 594 1.0E-34
sp|P09052|VASA1_DROME ATP-dependent RNA helicase vasa, isoform A OS=Drosophila melanogaster GN=vas PE=1 SV=3 146 568 2.0E-34
sp|Q814I2|DBPA_BACCR ATP-dependent RNA helicase DbpA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dbpA PE=2 SV=1 148 568 2.0E-34
sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 146 566 2.0E-34
sp|O15523|DDX3Y_HUMAN ATP-dependent RNA helicase DDX3Y OS=Homo sapiens GN=DDX3Y PE=1 SV=2 55 566 2.0E-34
sp|Q8PFZ3|RHLB_XANAC ATP-dependent RNA helicase RhlB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rhlB PE=3 SV=1 139 565 2.0E-34
sp|A2QI25|DED1_ASPNC ATP-dependent RNA helicase ded1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ded1 PE=3 SV=1 146 592 2.0E-34
sp|P44586|DEAD_HAEIN ATP-dependent RNA helicase DeaD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=deaD PE=3 SV=1 143 619 2.0E-34
sp|Q3BNH8|RHLB_XANC5 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rhlB PE=3 SV=1 139 565 3.0E-34
sp|Q9P6U9|DED1_NEUCR ATP-dependent RNA helicase ded1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-9 PE=3 SV=1 146 594 3.0E-34
sp|Q9C551|RH5_ARATH DEAD-box ATP-dependent RNA helicase 5 OS=Arabidopsis thaliana GN=RH5 PE=1 SV=1 134 568 3.0E-34
sp|Q0UWA6|DED1_PHANO ATP-dependent RNA helicase DED1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DED1 PE=3 SV=1 146 594 3.0E-34
sp|Q4WP13|DED1_ASPFU ATP-dependent RNA helicase ded1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ded1 PE=3 SV=1 146 592 3.0E-34
sp|A5E058|PRP5_LODEL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRP5 PE=3 SV=1 169 602 3.0E-34
sp|Q9VHP0|DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster GN=bel PE=1 SV=1 140 566 4.0E-34
sp|Q5L3G9|CSHA_GEOKA DEAD-box ATP-dependent RNA helicase CshA OS=Geobacillus kaustophilus (strain HTA426) GN=cshA PE=3 SV=1 146 568 4.0E-34
sp|Q0CZN5|DRS1_ASPTN ATP-dependent RNA helicase drs1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=drs1 PE=3 SV=1 130 563 4.0E-34
sp|Q4PEX7|DBP8_USTMA ATP-dependent RNA helicase DBP8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP8 PE=3 SV=2 148 566 4.0E-34
sp|Q6CQA1|MS116_KLULA ATP-dependent RNA helicase MSS116, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MSS116 PE=3 SV=1 162 583 5.0E-34
sp|A2YV85|RH29_ORYSI DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. indica GN=OsI_028228 PE=2 SV=2 144 566 6.0E-34
sp|Q2UQI6|DRS1_ASPOR ATP-dependent RNA helicase drs1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=drs1 PE=3 SV=2 122 563 6.0E-34
sp|O74764|SPB4_SCHPO ATP-dependent rRNA helicase spb4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spb4 PE=3 SV=1 148 709 6.0E-34
sp|A3BT52|RH29_ORYSJ DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. japonica GN=Os08g0416100 PE=2 SV=2 144 566 7.0E-34
sp|P53734|DBP6_YEAST ATP-dependent RNA helicase DBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP6 PE=1 SV=1 187 576 7.0E-34
sp|Q8TDD1|DDX54_HUMAN ATP-dependent RNA helicase DDX54 OS=Homo sapiens GN=DDX54 PE=1 SV=2 116 568 7.0E-34
sp|Q6DRI7|DDX51_DANRE ATP-dependent RNA helicase DDX51 OS=Danio rerio GN=ddx51 PE=2 SV=1 173 584 8.0E-34
sp|Q75B50|DED1_ASHGO ATP-dependent RNA helicase DED1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DED1 PE=3 SV=2 146 578 9.0E-34
sp|Q750Q4|MS116_ASHGO ATP-dependent RNA helicase MSS116, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MSS116 PE=3 SV=1 153 566 1.0E-33
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana GN=RH14 PE=1 SV=2 146 566 1.0E-33
sp|Q6FU81|MS116_CANGA ATP-dependent RNA helicase MSS116, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MSS116 PE=3 SV=1 50 579 1.0E-33
sp|Q2UMH8|DBP3_ASPOR ATP-dependent RNA helicase dbp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp3 PE=3 SV=1 166 600 1.0E-33
sp|Q3B8Q1|DDX21_RAT Nucleolar RNA helicase 2 OS=Rattus norvegicus GN=Ddx21 PE=2 SV=1 149 566 1.0E-33
sp|A4R8G3|DBP8_MAGO7 ATP-dependent RNA helicase DBP8 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP8 PE=3 SV=3 141 566 1.0E-33
sp|Q754U8|PRP5_ASHGO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP5 PE=3 SV=2 146 567 1.0E-33
sp|Q9JIK5|DDX21_MOUSE Nucleolar RNA helicase 2 OS=Mus musculus GN=Ddx21 PE=1 SV=3 149 565 1.0E-33
sp|A7F8V8|DBP7_SCLS1 ATP-dependent RNA helicase dbp7 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp7 PE=3 SV=1 1 73 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0008144 drug binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|162
MADDGLVLNFELGSGPLKPQVKFTGGRWRDRKRAQKSARLASRRPATGHDDDDGEQRSSKRRRFDGERSSQSGPG
AETPKEHEHRRHDKSTSDGAVGPKNPVADSTKPSRQVISRLFSFNPAQTTATTSEEEWTAPQATNAPLADVANFG
SLTLSSRLVDELGKMNLNRPTAIQLKVIPHMLSSSSDAFVQAETGSGKTFSYLLPIIHRVLLLSGSGDGKQVHRD
SGVFAIIVSPTRELARQVHTVLEQLIRPFPWLVSTAITGGESKKAEKARIRKGVNFLVATPGRLADHIDNTKALS
LATVRWLILDEGDRLMDLGFEQDLKKAVSALRAIPLAKKTSNGTALDSLPERRVTILCSATMKMNVQKLGEMSLS
DAALLAAEKTGEDAKEDQVVHKAPAQLHQSYTIVPSKLRLVTLISHLKSVFSRRGRTMKAIIFMSCADSVDFHYE
LLRQPGDQETSSRDAELIAKTVCKSAYFTSAASPEIVLHRMHGSLSQPTRTATIRSFSACKSPSVLITTDVSSRG
LDIPSVDLVVEYDPAFSFADHIHRVGRTARAGRPGDALLFLLPGSEEGYIELLKSSTSPSPMPYESVLKTGLMAK
LEFPVETVAAPSDESSYHDKAEMLQLHIEQRLLNDAKRLELARNGFKSHIRAYATHVKDERVHFDITQLHLGHVA
KSFGLREAPGGIGAGLERKAKRGQGPRDQTRDQAGDQGQGQRPARDVIKEKSRMLMRAAADEFNIG*
Coding >Hirsu2|162
ATGGCCGACGACGGTCTGGTACTGAATTTTGAGCTCGGGAGCGGGCCGCTCAAGCCCCAGGTCAAGTTCACAGGC
GGCCGATGGCGTGATAGGAAACGCGCGCAGAAGAGCGCCCGACTCGCCTCGCGCCGCCCGGCGACAGGCCACGAC
GACGATGACGGAGAACAAAGATCCTCCAAACGTCGCCGATTCGATGGCGAGAGAAGCTCCCAGTCAGGCCCGGGA
GCCGAGACACCAAAGGAGCATGAGCACCGCCGTCACGACAAGTCAACATCGGACGGCGCCGTTGGGCCCAAGAAT
CCCGTGGCAGACTCGACCAAGCCGTCTCGTCAAGTCATTTCCCGCCTCTTCTCCTTCAATCCAGCCCAGACGACA
GCCACGACGTCCGAAGAAGAATGGACAGCACCGCAGGCCACCAATGCGCCGCTTGCAGACGTTGCCAACTTCGGG
TCGCTGACCCTCTCGTCGCGACTGGTGGACGAGCTGGGCAAGATGAACCTGAATCGCCCGACTGCGATTCAGCTC
AAAGTCATCCCTCACATGCTTTCCAGCAGCTCCGACGCCTTCGTTCAAGCAGAGACGGGCTCGGGCAAAACATTC
TCCTACCTCTTGCCCATCATCCATCGTGTACTGCTCCTGAGCGGCTCCGGAGACGGCAAGCAGGTACACCGAGAC
TCGGGTGTCTTCGCCATCATCGTTTCCCCGACCCGCGAGCTGGCCAGACAGGTTCACACGGTGCTCGAGCAACTC
ATACGGCCCTTCCCCTGGCTTGTTTCCACGGCCATCACCGGCGGCGAGTCCAAGAAGGCTGAAAAGGCAAGAATC
CGCAAGGGCGTCAACTTTCTGGTCGCAACTCCCGGCCGGCTGGCTGATCACATAGACAACACAAAAGCCTTGAGT
CTCGCGACTGTGCGATGGCTGATTCTCGATGAAGGCGACCGTCTGATGGACTTGGGCTTCGAGCAGGACCTGAAG
AAGGCCGTCTCTGCTCTGCGGGCCATTCCTCTTGCAAAAAAAACGAGCAACGGTACTGCACTCGACTCTCTACCC
GAACGACGGGTTACCATCCTCTGCTCCGCCACCATGAAGATGAATGTGCAGAAGCTCGGTGAGATGAGCTTGTCA
GATGCAGCCCTTTTAGCTGCCGAGAAGACTGGGGAGGATGCCAAGGAGGACCAAGTGGTGCACAAGGCCCCTGCA
CAGTTGCATCAGTCGTACACCATCGTCCCGTCGAAGCTCCGCCTGGTTACACTCATCTCCCATCTCAAATCCGTC
TTCTCTCGCCGGGGCCGGACGATGAAAGCCATCATCTTCATGTCCTGTGCGGATTCCGTCGACTTTCACTACGAA
CTTCTCAGACAGCCGGGCGATCAGGAGACGTCTTCGAGAGACGCGGAGCTGATTGCGAAGACGGTGTGCAAGTCA
GCCTATTTCACCTCTGCTGCCAGCCCGGAAATCGTCCTCCATAGGATGCACGGCTCACTGAGCCAGCCAACGCGT
ACAGCAACGATACGCTCGTTCTCGGCATGCAAGTCTCCGTCCGTTCTCATCACCACAGATGTTTCATCGCGCGGA
CTGGACATCCCGTCCGTCGACCTGGTCGTCGAGTATGATCCAGCTTTCAGCTTCGCGGACCATATCCATCGCGTA
GGTCGAACGGCTCGTGCTGGACGTCCCGGCGATGCGCTATTGTTTCTCCTGCCCGGCTCAGAGGAAGGCTACATA
GAGCTCCTCAAGTCTTCTACGTCGCCCTCACCGATGCCTTACGAGTCGGTTCTCAAAACGGGGCTCATGGCCAAG
CTGGAGTTCCCGGTCGAGACTGTTGCGGCCCCTTCGGACGAGTCATCGTATCATGACAAAGCAGAGATGTTGCAG
CTGCACATCGAGCAACGCCTTCTCAATGATGCTAAACGATTGGAACTGGCGCGCAACGGTTTCAAGTCACACATC
CGGGCGTACGCAACGCATGTCAAAGACGAGCGCGTGCATTTCGACATTACTCAGTTGCACCTGGGTCACGTTGCC
AAAAGCTTCGGTCTTAGGGAGGCGCCCGGTGGCATTGGAGCCGGCCTGGAGCGTAAGGCGAAGAGGGGCCAGGGT
CCAAGGGATCAGACCAGGGACCAGGCTGGGGACCAGGGGCAGGGCCAAAGGCCCGCGCGAGACGTGATCAAGGAG
AAGAGCAGGATGCTGATGCGCGCTGCGGCCGACGAATTCAATATCGGATAG
Transcript >Hirsu2|162
ATGGCCGACGACGGTCTGGTACTGAATTTTGAGCTCGGGAGCGGGCCGCTCAAGCCCCAGGTCAAGTTCACAGGC
GGCCGATGGCGTGATAGGAAACGCGCGCAGAAGAGCGCCCGACTCGCCTCGCGCCGCCCGGCGACAGGCCACGAC
GACGATGACGGAGAACAAAGATCCTCCAAACGTCGCCGATTCGATGGCGAGAGAAGCTCCCAGTCAGGCCCGGGA
GCCGAGACACCAAAGGAGCATGAGCACCGCCGTCACGACAAGTCAACATCGGACGGCGCCGTTGGGCCCAAGAAT
CCCGTGGCAGACTCGACCAAGCCGTCTCGTCAAGTCATTTCCCGCCTCTTCTCCTTCAATCCAGCCCAGACGACA
GCCACGACGTCCGAAGAAGAATGGACAGCACCGCAGGCCACCAATGCGCCGCTTGCAGACGTTGCCAACTTCGGG
TCGCTGACCCTCTCGTCGCGACTGGTGGACGAGCTGGGCAAGATGAACCTGAATCGCCCGACTGCGATTCAGCTC
AAAGTCATCCCTCACATGCTTTCCAGCAGCTCCGACGCCTTCGTTCAAGCAGAGACGGGCTCGGGCAAAACATTC
TCCTACCTCTTGCCCATCATCCATCGTGTACTGCTCCTGAGCGGCTCCGGAGACGGCAAGCAGGTACACCGAGAC
TCGGGTGTCTTCGCCATCATCGTTTCCCCGACCCGCGAGCTGGCCAGACAGGTTCACACGGTGCTCGAGCAACTC
ATACGGCCCTTCCCCTGGCTTGTTTCCACGGCCATCACCGGCGGCGAGTCCAAGAAGGCTGAAAAGGCAAGAATC
CGCAAGGGCGTCAACTTTCTGGTCGCAACTCCCGGCCGGCTGGCTGATCACATAGACAACACAAAAGCCTTGAGT
CTCGCGACTGTGCGATGGCTGATTCTCGATGAAGGCGACCGTCTGATGGACTTGGGCTTCGAGCAGGACCTGAAG
AAGGCCGTCTCTGCTCTGCGGGCCATTCCTCTTGCAAAAAAAACGAGCAACGGTACTGCACTCGACTCTCTACCC
GAACGACGGGTTACCATCCTCTGCTCCGCCACCATGAAGATGAATGTGCAGAAGCTCGGTGAGATGAGCTTGTCA
GATGCAGCCCTTTTAGCTGCCGAGAAGACTGGGGAGGATGCCAAGGAGGACCAAGTGGTGCACAAGGCCCCTGCA
CAGTTGCATCAGTCGTACACCATCGTCCCGTCGAAGCTCCGCCTGGTTACACTCATCTCCCATCTCAAATCCGTC
TTCTCTCGCCGGGGCCGGACGATGAAAGCCATCATCTTCATGTCCTGTGCGGATTCCGTCGACTTTCACTACGAA
CTTCTCAGACAGCCGGGCGATCAGGAGACGTCTTCGAGAGACGCGGAGCTGATTGCGAAGACGGTGTGCAAGTCA
GCCTATTTCACCTCTGCTGCCAGCCCGGAAATCGTCCTCCATAGGATGCACGGCTCACTGAGCCAGCCAACGCGT
ACAGCAACGATACGCTCGTTCTCGGCATGCAAGTCTCCGTCCGTTCTCATCACCACAGATGTTTCATCGCGCGGA
CTGGACATCCCGTCCGTCGACCTGGTCGTCGAGTATGATCCAGCTTTCAGCTTCGCGGACCATATCCATCGCGTA
GGTCGAACGGCTCGTGCTGGACGTCCCGGCGATGCGCTATTGTTTCTCCTGCCCGGCTCAGAGGAAGGCTACATA
GAGCTCCTCAAGTCTTCTACGTCGCCCTCACCGATGCCTTACGAGTCGGTTCTCAAAACGGGGCTCATGGCCAAG
CTGGAGTTCCCGGTCGAGACTGTTGCGGCCCCTTCGGACGAGTCATCGTATCATGACAAAGCAGAGATGTTGCAG
CTGCACATCGAGCAACGCCTTCTCAATGATGCTAAACGATTGGAACTGGCGCGCAACGGTTTCAAGTCACACATC
CGGGCGTACGCAACGCATGTCAAAGACGAGCGCGTGCATTTCGACATTACTCAGTTGCACCTGGGTCACGTTGCC
AAAAGCTTCGGTCTTAGGGAGGCGCCCGGTGGCATTGGAGCCGGCCTGGAGCGTAAGGCGAAGAGGGGCCAGGGT
CCAAGGGATCAGACCAGGGACCAGGCTGGGGACCAGGGGCAGGGCCAAAGGCCCGCGCGAGACGTGATCAAGGAG
AAGAGCAGGATGCTGATGCGCGCTGCGGCCGACGAATTCAATATCGGATAG
Gene >Hirsu2|162
ATGGCCGACGACGGTCTGGTACTGAATTTTGAGCTCGGGAGCGGGCCGCTCAAGCCCCAGGTCAAGTTCACAGGC
GGCCGATGGCGTGATAGGAAACGCGCGCAGAAGAGCGCCCGACTCGCCTCGCGCCGCCCGGCGACAGGCCACGAC
GACGATGACGGAGAACAAAGATCCTCCAAACGTCGCCGATTCGATGGCGAGAGAAGCTCCCAGTCAGGCCCGGGA
GCCGAGACACCAAAGGAGCATGAGCACCGCCGTCACGACAAGTCAACATCGGACGGCGCCGTTGGGCCCAAGAAT
CCCGTGGCAGACTCGACCAAGCCGTCTCGTCAAGTCATTTCCCGCCTCTTCTCCTTCAATCCAGCCCAGACGACA
GCCACGACGTCCGAAGAAGAATGGACAGCACCGCAGGCCACCAATGCGCCGCTTGCAGACGTTGCCAACTTCGGG
TCGCTGACCCTCTCGTCGCGACTGGTGGACGAGCTGGGCAAGATGAACCTGAATCGCCCGACTGCGATTCAGCTC
AAAGTCATCCCTCACATGCTTTCCAGCAGCTCCGACGCCTTCGTTCAAGCAGAGACGGGCTCGGGCAAAACATTC
TCCTACCTCTTGCCCATCATCCATCGTGTACTGCTCCTGAGCGGCTCCGGAGACGGCAAGCAGGTACACCGAGAC
TCGGGTGTCTTCGCCATCATCGTTTCCCCGACCCGCGAGCTGGCCAGACAGGTTCACACGGTGCTCGAGCAACTC
ATACGGCCCTTCCCCTGGCTTGTTTCCACGGCCATCACCGGCGGCGAGTCCAAGAAGGCTGAAAAGGCAAGAATC
CGCAAGGGCGTCAACTTTCTGGTCGCAACTCCCGGCCGGCTGGCTGATCACATAGACAACACAAAAGCCTTGAGT
CTCGCGACTGTGCGATGGCTGATTCTCGATGAAGGCGACCGTCTGATGGACTTGGGCTTCGAGCAGGACCTGAAG
AAGGCCGTCTCTGCTCTGCGGGCCATTCCTCTTGCAAAAAAAACGAGCAACGGTACTGCACTCGACTCTCTACCC
GAACGACGGGTTACCATCCTCTGCTCCGCCACCATGAAGATGAATGTGCAGAAGCTCGGTGAGATGAGCTTGTCA
GATGCAGCCCTTTTAGCTGCCGAGAAGACTGGGGAGGATGCCAAGGAGGACCAAGTGGTGCACAAGGCCCCTGCA
CAGTTGCATCAGTCGTACACCATCGTCCCGTCGAAGCTCCGCCTGGTTACACTCATCTCCCATCTCAAATCCGTC
TTCTCTCGCCGGGGCCGGACGATGAAAGCCATCATCTTCATGTCCTGTGCGGATTCCGTCGACTTTCACTACGAA
CTTCTCAGACAGCCGGGCGATCAGGAGACGTCTTCGAGAGACGCGGAGCTGATTGCGAAGACGGTGTGCAAGTCA
GCCTATTTCACCTCTGCTGCCAGCCCGGAAATCGTCCTCCATAGGATGCACGGCTCACTGAGCCAGCCAACGCGT
ACAGCAACGATACGCTCGTTCTCGGCATGCAAGTCTCCGTCCGTTCTCATCACCACAGATGTTTCATCGCGCGGA
CTGGACATCCCGTCCGTCGACCTGGTCGTCGAGTATGATCCAGCTTTCAGCTTCGCGGACCATATCCATCGCGTA
GGTCGAACGGCTCGTGCTGGACGTCCCGGCGATGCGCTATTGTTTCTCCTGCCCGGCTCAGAGGAAGGCTACATA
GAGCTCCTCAAGTCTTCTACGTCGCCCTCACCGATGCCTTACGAGTCGGTTCTCAAAACGGGGCTCATGGCCAAG
CTGGAGTTCCCGGTCGAGACTGTTGCGGCCCCTTCGGACGAGTCATCGTATCATGACAAAGCAGAGATGTTGCAG
CTGCACATCGAGCAACGCCTTCTCAATGATGCTAAACGATTGGAACTGGCGCGCAACGGTTTCAAGTCACACATC
CGGGCGTACGCAACGCATGTCAAAGACGAGCGCGTGCATTTCGACATTACTCAGTTGCACCTGGGTCACGTTGCC
AAAAGCTTCGGTCTTAGGGAGGCGCCCGGTGGCATTGGAGCCGGCCTGGAGCGTAAGGCGAAGAGGGGCCAGGGT
CCAAGGGATCAGACCAGGGACCAGGCTGGGGACCAGGGGCAGGGCCAAAGGCCCGCGCGAGACGTGATCAAGGAG
AAGAGCAGGATGCTGATGCGCGCTGCGGCCGACGAATTCAATATCGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail