Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1610
Gene name
LocationContig_136:31416..32553
Strand-
Gene length (bp)1137
Transcript length (bp)1137
Coding sequence length (bp)1137
Protein length (aa) 379

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03055 RPE65 Retinal pigment epithelial membrane protein 7.5E-68 4 364

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C3VEQ4|CCD1_ONCHC Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Oncidium hybrid cultivar GN=CCD1 PE=2 SV=1 1 373 9.0E-31
sp|Q84KG5|CCD_CROSA Carotenoid 9,10(9',10')-cleavage dioxygenase OS=Crocus sativus GN=CCD PE=1 SV=1 1 373 1.0E-28
sp|O65572|CCD1_ARATH Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Arabidopsis thaliana GN=CCD1 PE=1 SV=2 37 372 8.0E-27
sp|Q94IR2|CCD1_PHAVU Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Phaseolus vulgaris GN=CCD1 PE=1 SV=1 37 372 6.0E-26
sp|Q8LP17|CCD1_PEA Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Pisum sativum GN=CCD1 PE=2 SV=1 1 368 7.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C3VEQ4|CCD1_ONCHC Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Oncidium hybrid cultivar GN=CCD1 PE=2 SV=1 1 373 9.0E-31
sp|Q84KG5|CCD_CROSA Carotenoid 9,10(9',10')-cleavage dioxygenase OS=Crocus sativus GN=CCD PE=1 SV=1 1 373 1.0E-28
sp|O65572|CCD1_ARATH Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Arabidopsis thaliana GN=CCD1 PE=1 SV=2 37 372 8.0E-27
sp|Q94IR2|CCD1_PHAVU Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Phaseolus vulgaris GN=CCD1 PE=1 SV=1 37 372 6.0E-26
sp|Q8LP17|CCD1_PEA Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Pisum sativum GN=CCD1 PE=2 SV=1 1 368 7.0E-26
sp|Q84K96|ZCD_CROSA Zeaxanthin 7,8(7',8')-cleavage dioxygenase, chromoplastic OS=Crocus sativus GN=ZCD PE=1 SV=1 9 373 4.0E-15
sp|Q9M9F5|NCED9_ARATH 9-cis-epoxycarotenoid dioxygenase NCED9, chloroplastic OS=Arabidopsis thaliana GN=NCED9 PE=2 SV=1 266 372 1.0E-08
sp|C3VEQ3|NCED_ONCHC 9-cis-epoxycarotenoid dioxygenase, chloroplastic OS=Oncidium hybrid cultivar GN=NCED PE=2 SV=1 36 116 2.0E-06
sp|P74334|ACOX_SYNY3 Apocarotenoid-15,15'-oxygenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1541 PE=1 SV=1 290 363 3.0E-06
sp|C3VEQ3|NCED_ONCHC 9-cis-epoxycarotenoid dioxygenase, chloroplastic OS=Oncidium hybrid cultivar GN=NCED PE=2 SV=1 296 372 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen Yes
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0051213 dioxygenase activity No
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1610
MIQFHSTFIWPYVRYSVLPAASADRKRAASIAPFGVPVPGIVSPKMMHDLGVSRHHTVIIDTPMYLNPFHLLCGK
PVIGFDPREQTRFGVFPRHRPEAVEWFATEACCIFHTVNTWDETSKAAGRPATVHMLACRVSGRGNGPSFVYAAG
GLPVPEHVDVGEAHSKSREECRLYYYQFALNSNPPEIAQQWALSAIPFELPHIPRHLAMTATRFVYGCSVRRGDY
AEQLADSLKLSSLVKIDVRELIARGIKSPPTAAAECVDERSVSDILAADDPDDPVRIFPMPERWYAQECAFVPRA
GGASEDDGWLPTFAFDESQLDSNGDAPESARSELWIIDARTMRYVVARIRLPRRVPYGLHGNWFSAEDIALQHPV
AAF*
Coding >Hirsu2|1610
ATGATACAGTTTCATTCAACTTTCATCTGGCCCTATGTCAGATACTCGGTCCTCCCAGCTGCATCGGCAGACCGA
AAGCGTGCCGCCAGCATCGCGCCCTTCGGAGTGCCCGTGCCGGGCATCGTGTCGCCGAAGATGATGCACGACTTG
GGCGTGTCTCGCCACCACACCGTCATCATAGACACGCCGATGTATTTGAATCCCTTCCACCTGCTTTGCGGGAAG
CCCGTCATCGGCTTCGACCCTCGGGAGCAGACACGCTTCGGCGTCTTTCCGCGCCACAGGCCCGAGGCCGTCGAG
TGGTTCGCCACGGAGGCCTGCTGCATCTTCCACACCGTGAACACCTGGGACGAGACGAGCAAAGCAGCTGGGCGA
CCAGCCACGGTGCATATGCTTGCCTGTCGAGTAAGCGGCCGAGGAAACGGCCCATCTTTCGTGTATGCCGCGGGC
GGCCTGCCAGTGCCCGAGCACGTTGACGTGGGCGAAGCGCACTCGAAATCGAGAGAGGAGTGCCGTCTATATTAC
TACCAATTCGCGCTCAACAGCAACCCTCCGGAGATCGCGCAGCAATGGGCTCTGAGCGCGATCCCCTTCGAGCTC
CCCCACATACCCAGGCACCTGGCGATGACTGCTACTCGCTTTGTTTACGGCTGCTCGGTGCGAAGAGGCGACTAC
GCCGAGCAGCTGGCCGACTCGTTGAAGCTCAGCAGCCTGGTCAAAATAGACGTGCGGGAACTGATCGCCAGGGGA
ATCAAGTCCCCTCCCACAGCTGCAGCCGAGTGTGTCGACGAGCGGTCTGTTAGCGACATCCTGGCGGCAGACGAT
CCGGACGACCCCGTGCGGATCTTCCCCATGCCGGAAAGATGGTATGCGCAGGAGTGTGCCTTTGTGCCTCGTGCT
GGGGGCGCTTCGGAAGACGACGGCTGGCTCCCGACCTTCGCCTTCGACGAGTCCCAGCTCGACAGCAACGGGGAC
GCTCCGGAAAGCGCCAGAAGCGAGCTTTGGATCATCGACGCCCGGACCATGCGTTACGTCGTGGCTCGCATCAGA
TTGCCGCGACGGGTGCCGTACGGGCTGCATGGAAACTGGTTTTCGGCGGAGGATATCGCTTTACAGCACCCAGTG
GCGGCATTCTGA
Transcript >Hirsu2|1610
ATGATACAGTTTCATTCAACTTTCATCTGGCCCTATGTCAGATACTCGGTCCTCCCAGCTGCATCGGCAGACCGA
AAGCGTGCCGCCAGCATCGCGCCCTTCGGAGTGCCCGTGCCGGGCATCGTGTCGCCGAAGATGATGCACGACTTG
GGCGTGTCTCGCCACCACACCGTCATCATAGACACGCCGATGTATTTGAATCCCTTCCACCTGCTTTGCGGGAAG
CCCGTCATCGGCTTCGACCCTCGGGAGCAGACACGCTTCGGCGTCTTTCCGCGCCACAGGCCCGAGGCCGTCGAG
TGGTTCGCCACGGAGGCCTGCTGCATCTTCCACACCGTGAACACCTGGGACGAGACGAGCAAAGCAGCTGGGCGA
CCAGCCACGGTGCATATGCTTGCCTGTCGAGTAAGCGGCCGAGGAAACGGCCCATCTTTCGTGTATGCCGCGGGC
GGCCTGCCAGTGCCCGAGCACGTTGACGTGGGCGAAGCGCACTCGAAATCGAGAGAGGAGTGCCGTCTATATTAC
TACCAATTCGCGCTCAACAGCAACCCTCCGGAGATCGCGCAGCAATGGGCTCTGAGCGCGATCCCCTTCGAGCTC
CCCCACATACCCAGGCACCTGGCGATGACTGCTACTCGCTTTGTTTACGGCTGCTCGGTGCGAAGAGGCGACTAC
GCCGAGCAGCTGGCCGACTCGTTGAAGCTCAGCAGCCTGGTCAAAATAGACGTGCGGGAACTGATCGCCAGGGGA
ATCAAGTCCCCTCCCACAGCTGCAGCCGAGTGTGTCGACGAGCGGTCTGTTAGCGACATCCTGGCGGCAGACGAT
CCGGACGACCCCGTGCGGATCTTCCCCATGCCGGAAAGATGGTATGCGCAGGAGTGTGCCTTTGTGCCTCGTGCT
GGGGGCGCTTCGGAAGACGACGGCTGGCTCCCGACCTTCGCCTTCGACGAGTCCCAGCTCGACAGCAACGGGGAC
GCTCCGGAAAGCGCCAGAAGCGAGCTTTGGATCATCGACGCCCGGACCATGCGTTACGTCGTGGCTCGCATCAGA
TTGCCGCGACGGGTGCCGTACGGGCTGCATGGAAACTGGTTTTCGGCGGAGGATATCGCTTTACAGCACCCAGTG
GCGGCATTCTGA
Gene >Hirsu2|1610
ATGATACAGTTTCATTCAACTTTCATCTGGCCCTATGTCAGATACTCGGTCCTCCCAGCTGCATCGGCAGACCGA
AAGCGTGCCGCCAGCATCGCGCCCTTCGGAGTGCCCGTGCCGGGCATCGTGTCGCCGAAGATGATGCACGACTTG
GGCGTGTCTCGCCACCACACCGTCATCATAGACACGCCGATGTATTTGAATCCCTTCCACCTGCTTTGCGGGAAG
CCCGTCATCGGCTTCGACCCTCGGGAGCAGACACGCTTCGGCGTCTTTCCGCGCCACAGGCCCGAGGCCGTCGAG
TGGTTCGCCACGGAGGCCTGCTGCATCTTCCACACCGTGAACACCTGGGACGAGACGAGCAAAGCAGCTGGGCGA
CCAGCCACGGTGCATATGCTTGCCTGTCGAGTAAGCGGCCGAGGAAACGGCCCATCTTTCGTGTATGCCGCGGGC
GGCCTGCCAGTGCCCGAGCACGTTGACGTGGGCGAAGCGCACTCGAAATCGAGAGAGGAGTGCCGTCTATATTAC
TACCAATTCGCGCTCAACAGCAACCCTCCGGAGATCGCGCAGCAATGGGCTCTGAGCGCGATCCCCTTCGAGCTC
CCCCACATACCCAGGCACCTGGCGATGACTGCTACTCGCTTTGTTTACGGCTGCTCGGTGCGAAGAGGCGACTAC
GCCGAGCAGCTGGCCGACTCGTTGAAGCTCAGCAGCCTGGTCAAAATAGACGTGCGGGAACTGATCGCCAGGGGA
ATCAAGTCCCCTCCCACAGCTGCAGCCGAGTGTGTCGACGAGCGGTCTGTTAGCGACATCCTGGCGGCAGACGAT
CCGGACGACCCCGTGCGGATCTTCCCCATGCCGGAAAGATGGTATGCGCAGGAGTGTGCCTTTGTGCCTCGTGCT
GGGGGCGCTTCGGAAGACGACGGCTGGCTCCCGACCTTCGCCTTCGACGAGTCCCAGCTCGACAGCAACGGGGAC
GCTCCGGAAAGCGCCAGAAGCGAGCTTTGGATCATCGACGCCCGGACCATGCGTTACGTCGTGGCTCGCATCAGA
TTGCCGCGACGGGTGCCGTACGGGCTGCATGGAAACTGGTTTTCGGCGGAGGATATCGCTTTACAGCACCCAGTG
GCGGCATTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail