Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1607
Gene name
LocationContig_136:21009..22295
Strand-
Gene length (bp)1286
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily 5.3E-06 150 212

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1607
MADNPNQVPDGSDAVRADRGKAFKKGLLDALSCIQTPGSFASFARLADPPPAGLTVNGIGPITMPLSQSQAEQLV
AAARQAPYGKGSETIVDTSVRNTWELDATQFAFENPAWPGYLGWLCRHVAQQLGIGAPIRAEPYKMLFTEKIPSM
FGTLIICLPSAHQGGEVVLRHCGQKEVFKTSEAPQSFICWYSDVSHEVLPVTSGIRWVLTYNLALDASAHAARTS
ASLQQLETQALDAALQRWLAEDKDSRPKPFIYHTLDHEYTEANTSLKALKTRDLAQVQALLRHMSAKRSRNTWAT
R*
Coding >Hirsu2|1607
ATGGCCGACAATCCAAATCAAGTTCCCGATGGCTCCGACGCCGTACGAGCCGACCGCGGCAAGGCATTCAAGAAG
GGTCTCTTAGACGCCCTCTCGTGCATTCAGACCCCCGGGTCGTTTGCCTCTTTTGCACGTCTTGCCGATCCGCCG
CCGGCAGGCCTCACCGTCAACGGCATCGGCCCCATCACGATGCCGCTGTCGCAGTCTCAGGCGGAGCAGCTCGTT
GCCGCCGCGCGCCAGGCGCCCTACGGCAAGGGGAGCGAGACGATTGTCGACACTTCGGTCCGCAACACGTGGGAG
CTCGACGCGACGCAGTTTGCCTTCGAGAACCCGGCCTGGCCGGGCTATCTGGGATGGTTGTGCCGACATGTCGCC
CAGCAGCTCGGCATCGGGGCGCCAATTCGTGCTGAGCCGTATAAAATGCTGTTTACCGAGAAAATCCCATCCATG
TTTGGCACTCTCATCATCTGCCTCCCGTCCGCGCACCAAGGGGGAGAGGTGGTCCTCAGGCACTGCGGCCAGAAA
GAGGTGTTCAAGACGTCAGAGGCTCCGCAGTCATTCATCTGCTGGTACTCGGATGTGTCTCACGAGGTGCTCCCC
GTCACTTCGGGCATTCGCTGGGTGTTAACCTACAACCTCGCTCTCGATGCTTCAGCGCATGCGGCTCGTACGTCG
GCTAGCTTGCAGCAGTTGGAGACGCAGGCGCTCGATGCTGCGCTCCAGCGGTGGCTCGCCGAGGATAAGGACTCG
CGCCCGAAGCCCTTCATCTACCATACGCTCGACCACGAATATACCGAGGCCAACACGTCGCTCAAGGCCCTGAAA
ACGCGCGACCTGGCCCAGGTTCAGGCCCTCCTTCGGCACATGTCCGCCAAGCGTTCGAGGAACACATGGGCAACT
CGGTAA
Transcript >Hirsu2|1607
ATGGCCGACAATCCAAATCAAGTTCCCGATGGCTCCGACGCCGTACGAGCCGACCGCGGCAAGGCATTCAAGAAG
GGTCTCTTAGACGCCCTCTCGTGCATTCAGACCCCCGGGTCGTTTGCCTCTTTTGCACGTCTTGCCGATCCGCCG
CCGGCAGGCCTCACCGTCAACGGCATCGGCCCCATCACGATGCCGCTGTCGCAGTCTCAGGCGGAGCAGCTCGTT
GCCGCCGCGCGCCAGGCGCCCTACGGCAAGGGGAGCGAGACGATTGTCGACACTTCGGTCCGCAACACGTGGGAG
CTCGACGCGACGCAGTTTGCCTTCGAGAACCCGGCCTGGCCGGGCTATCTGGGATGGTTGTGCCGACATGTCGCC
CAGCAGCTCGGCATCGGGGCGCCAATTCGTGCTGAGCCGTATAAAATGCTGTTTACCGAGAAAATCCCATCCATG
TTTGGCACTCTCATCATCTGCCTCCCGTCCGCGCACCAAGGGGGAGAGGTGGTCCTCAGGCACTGCGGCCAGAAA
GAGGTGTTCAAGACGTCAGAGGCTCCGCAGTCATTCATCTGCTGGTACTCGGATGTGTCTCACGAGGTGCTCCCC
GTCACTTCGGGCATTCGCTGGGTGTTAACCTACAACCTCGCTCTCGATGCTTCAGCGCATGCGGCTCGTACGTCG
GCTAGCTTGCAGCAGTTGGAGACGCAGGCGCTCGATGCTGCGCTCCAGCGGTGGCTCGCCGAGGATAAGGACTCG
CGCCCGAAGCCCTTCATCTACCATACGCTCGACCACGAATATACCGAGGCCAACACGTCGCTCAAGGCCCTGAAA
ACGCGCGACCTGGCCCAGGTTCAGGCCCTCCTTCGGCACATGTCCGCCAAGCGTTCGAGGAACACATGGGCAACT
CGGTAA
Gene >Hirsu2|1607
ATGGCCGACAATCCAAATCAAGTTCCCGATGGCTCCGACGCCGTACGAGCCGACCGCGGCAAGGCATTCAAGAAG
GGTCTCTTAGACGCCCTCTCGTGCATTCAGACCCCCGGGTCGTTTGCCTCTTTTGCACGTCTTGCCGATCCGCCG
CCGGCAGGCCTCACCGTCAACGGCATCGGCCCCATCACGATGCCGCTGTCGCAGTCTCAGGCGGAGCAGCTCGTT
GCCGCCGCGCGCCAGGCGCCCTACGGCAAGGGGAGCGAGACGATTGTCGACACTTCGGTCCGCAACACGTGGGAG
CTCGACGCGACGCAGTTTGCCTTCGAGAACCCGGCCTGGCCGGGCTATCTGGGATGGTTGTGCCGACATGTCGCC
CAGCAGCTCGGCATCGGGGCGCCAATTCGTGCTGAGCCGTATAAAATGCTGTTGTATGAGAAGGGGGCTATGTTC
AAGCCGCATACAGAGTATGTCTTCCTTCCAATCGAGGTCGCTATGGCTGCGTTAATGGCTGCCGCATAGTACCGA
GAAAATCCCATCCATGTTTGGCACTCTCATCATCTGCCTCCCGTCCGCGCACCAAGGGGGAGAGGTGGTCCTCAG
GCACTGCGGCCAGAAAGAGGTGTTCAAGACGTCAGAGGCTCCGCAGTCATTCATCTGCTGGTACTCGGATGTGTC
TCACGAGGTGCTCCCCGTCACTTCGGGCATTCGCTGGGTGTTAACCTACAACCTCGCTCTCGATGCTTCAGCGCA
TGCGGCTCGTACGTCGGCTAGCTTGCAGCAGTTGGAGACGCAGGCGCTCGATGCTGCGCTCCAGCGGTGGCTCGC
CGAGGATAAGGACTCGCGCCCGAAGCCCTTCATCTACCATACGCTCGACCACGAATATACCGAGGCCAACACGTC
GCTCAAGGCCCTGAAAACGCGCGACCTGGCCCAGGTTCAGGCCCTCCTTCGGCACATGTCCGCCAAGCGGTCTAT
TCATGTATTTCTCGCACTCTTGGAAAAGGAGCAAGCCTCATGCTGCTATTACAACGGCTGGGGGAAAGGTTTTTA
CTGGGATGACGAAGACGATGAAGACAATGAGCTCGAAGAAGACGAGCTCGACTTTCACGAAGTCGATGAGGTTTT
CACGACTAATCATACGGTCCAGGCTCTTTTCGACTTGGAGGGCCATGTCGTCGCAAAGAGGCTGGAGCTGGATGA
AGACAGTGTCCTCCAACAAGACTGCTTTGGCAACCTGGAAGCTGATGACGAGCAGCAGTTCGAGGAACACATGGG
CAACTCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail