Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1605
Gene name
LocationContig_136:14033..16039
Strand+
Gene length (bp)2006
Transcript length (bp)1725
Coding sequence length (bp)1725
Protein length (aa) 575

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.7E-27 59 257
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-11 268 484

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 29 553 8.0E-48
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 5 498 5.0E-45
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 63 542 2.0E-31
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 60 505 3.0E-25
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 60 505 3.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 29 553 8.0E-48
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 5 498 5.0E-45
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 63 542 2.0E-31
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 60 505 3.0E-25
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 60 505 3.0E-25
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 14 542 6.0E-25
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 45 494 3.0E-23
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 35 394 1.0E-22
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 45 494 5.0E-22
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 39 487 1.0E-21
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 51 488 2.0E-20
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 71 497 2.0E-20
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 62 505 1.0E-19
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 51 400 6.0E-18
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 51 400 6.0E-18
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 46 385 4.0E-17
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 46 385 4.0E-17
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 21 491 2.0E-16
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 1 487 2.0E-12
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 57 488 3.0E-12
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 57 488 3.0E-12
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 9 493 4.0E-12
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 46 536 6.0E-12
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 46 536 6.0E-12
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 57 488 2.0E-11
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 25 376 2.0E-11
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 9 493 3.0E-11
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 54 486 2.0E-10
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 14 487 2.0E-10
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 57 488 3.0E-10
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 62 494 6.0E-10
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 51 493 1.0E-09
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 60 382 2.0E-09
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 60 382 2.0E-09
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 57 488 2.0E-09
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 87 511 2.0E-09
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 57 488 3.0E-09
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 57 488 4.0E-09
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 57 488 4.0E-09
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 57 488 4.0E-09
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 57 488 5.0E-09
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 57 488 5.0E-09
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 57 488 6.0E-09
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 91 495 6.0E-09
sp|P34698|Y5813_SACEN Uncharacterized MFS-type transporter SACE_5813 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_5813 PE=3 SV=2 73 487 1.0E-08
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 57 488 1.0E-08
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 75 437 2.0E-08
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 57 488 3.0E-08
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 2 230 5.0E-08
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 49 499 6.0E-08
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 57 488 7.0E-08
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 60 212 1.0E-07
sp|B7LV41|MDTD_ESCF3 Putative multidrug resistance protein MdtD OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtD PE=3 SV=1 57 488 3.0E-07
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 9 248 5.0E-07
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 75 508 5.0E-07
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 75 508 5.0E-07
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 75 508 5.0E-07
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 87 531 8.0E-07
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 75 371 1.0E-06
sp|P13924|TCR_STRAG Tetracycline resistance protein OS=Streptococcus agalactiae GN=tet PE=3 SV=1 75 508 1.0E-06
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 45 514 1.0E-06
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 45 514 1.0E-06
sp|B7MWZ0|MDTD_ECO81 Putative multidrug resistance protein MdtD OS=Escherichia coli O81 (strain ED1a) GN=mdtD PE=3 SV=1 57 488 1.0E-06
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 75 508 1.0E-06
sp|A1ACT2|MDTD_ECOK1 Putative multidrug resistance protein MdtD OS=Escherichia coli O1:K1 / APEC GN=mdtD PE=3 SV=1 57 488 3.0E-06
sp|P0A4K5|PMRA_STRR6 Multi-drug resistance efflux pump PmrA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pmrA PE=3 SV=1 60 230 3.0E-06
sp|P0A4K4|PMRA_STRPN Multi-drug resistance efflux pump PmrA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pmrA PE=3 SV=1 60 230 3.0E-06
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 40 390 4.0E-06
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 40 390 4.0E-06
sp|Q1R9Z4|MDTD_ECOUT Putative multidrug resistance protein MdtD OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtD PE=3 SV=1 57 488 4.0E-06
sp|B7ME89|MDTD_ECO45 Putative multidrug resistance protein MdtD OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtD PE=3 SV=1 57 488 4.0E-06
sp|P94574|YWOD_BACSU Uncharacterized MFS-type transporter YwoD OS=Bacillus subtilis (strain 168) GN=ywoD PE=3 SV=1 46 269 4.0E-06
sp|B6HYS2|MDTD_ECOSE Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SE11) GN=mdtD PE=3 SV=1 57 488 4.0E-06
sp|B2TYA6|MDTD_SHIB3 Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtD PE=3 SV=1 57 488 4.0E-06
sp|P36554|MDTD_ECOLI Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12) GN=mdtD PE=1 SV=2 57 488 4.0E-06
sp|B1IYZ7|MDTD_ECOLC Putative multidrug resistance protein MdtD OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtD PE=3 SV=1 57 488 4.0E-06
sp|A8A1U9|MDTD_ECOHS Putative multidrug resistance protein MdtD OS=Escherichia coli O9:H4 (strain HS) GN=mdtD PE=3 SV=1 57 488 4.0E-06
sp|B1X7H3|MDTD_ECODH Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / DH10B) GN=mdtD PE=3 SV=1 57 488 4.0E-06
sp|C4ZSG5|MDTD_ECOBW Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtD PE=3 SV=1 57 488 4.0E-06
sp|B7M460|MDTD_ECO8A Putative multidrug resistance protein MdtD OS=Escherichia coli O8 (strain IAI1) GN=mdtD PE=3 SV=1 57 488 5.0E-06
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 43 491 5.0E-06
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 61 508 5.0E-06
sp|Q0TG13|MDTD_ECOL5 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtD PE=3 SV=1 57 488 6.0E-06
sp|B7UTB5|MDTD_ECO27 Putative multidrug resistance protein MdtD OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtD PE=3 SV=1 57 488 6.0E-06
sp|B5YUD5|MDTD_ECO5E Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtD PE=3 SV=1 57 488 7.0E-06
sp|Q8X7I3|MDTD_ECO57 Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 GN=mdtD PE=3 SV=1 57 488 7.0E-06
sp|B7L9V0|MDTD_ECO55 Putative multidrug resistance protein MdtD OS=Escherichia coli (strain 55989 / EAEC) GN=mdtD PE=3 SV=1 57 488 8.0E-06
sp|Q83QZ0|MDTD_SHIFL Putative multidrug resistance protein MdtD OS=Shigella flexneri GN=mdtD PE=3 SV=1 57 488 8.0E-06
sp|B1LNW4|MDTD_ECOSM Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtD PE=3 SV=1 57 488 8.0E-06
sp|B7NCB3|MDTD_ECOLU Putative multidrug resistance protein MdtD OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtD PE=3 SV=1 57 488 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

Domain # Start End Length
1 52 74 22
2 89 111 22
3 118 137 19
4 147 169 22
5 182 204 22
6 208 230 22
7 251 273 22
8 283 305 22
9 339 361 22
10 376 398 22
11 403 425 22
12 435 457 22
13 469 491 22
14 523 545 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1605
MEPSSASGEALPSNTEKNGPVFVKSSSYSSDDFKHADPDGPGLSLSRARSIALVATVAGGSFLNTASIQSVVIIL
PSIGRELSVPNSRQQWIVSSYSLAFSCFLLFWGRVADIYGKRLIFILGSVWVTLMMATTPFMPNEIAFNLFRALH
GLGAAANVPTAIGILGVTFPRGKAQNYAFSTYAAGAPLGNVFGNLISGLIAQYANWRWVFGVSAIMAGLVVVAGI
VFIPHATINAASRVEMSAHGTNSSPLSRLSIDWIGVVLITSGLIALMFALTEGSVVGWRTPWVPVTIIASLLVIA
IFVLWQSRLERLHGSQCGHTPSLLRPPPLIKVSIFRNLRFSAAIVIIGFFFASFGSFLVYATYYFQDFQGLSPLQ
TMLRFIPTGLVGALITVIVAQLLDRVPTFYILVCGNIAVPIASLLFAVPISPTTSYFAYGLPAMVLCVVGADTIW
PCLGLLISQALPPEDQAMGGALITAIGQFGRAIGLAISTSVQTAVVAGARGMPVDTEEVGPIRPWEPESLRGLRA
ASWTNFGFGVISLAIVLVAFRSRDIVGKTTCSSLAQGRPDPEEDGERRV*
Coding >Hirsu2|1605
ATGGAGCCCTCGTCAGCCTCAGGTGAGGCGCTCCCTAGCAACACCGAAAAAAACGGACCGGTCTTTGTGAAGTCC
AGCTCCTATTCCTCAGACGATTTCAAGCATGCGGACCCCGATGGCCCTGGCCTGTCTCTTTCTCGAGCCCGGTCC
ATCGCCCTCGTAGCTACCGTTGCGGGTGGCTCCTTTCTTAATACGGCATCTATCCAAAGCGTTGTTATTATCCTG
CCCAGTATTGGCCGCGAGCTCTCCGTGCCAAACAGCCGGCAGCAATGGATCGTCTCATCATACTCGCTCGCCTTC
AGCTGCTTCCTGCTTTTCTGGGGCCGCGTTGCTGATATATACGGCAAGCGCCTCATCTTTATCCTCGGCTCTGTC
TGGGTCACCCTTATGATGGCTACTACCCCGTTTATGCCCAATGAAATTGCCTTTAACCTCTTCCGCGCTTTACAT
GGGCTGGGTGCTGCGGCCAACGTTCCGACGGCGATTGGCATTCTCGGCGTGACATTTCCACGTGGAAAGGCCCAG
AACTACGCCTTCAGTACCTACGCTGCGGGAGCTCCCCTCGGCAATGTGTTCGGGAACCTCATTTCGGGACTCATC
GCTCAGTACGCCAACTGGAGATGGGTGTTTGGTGTTTCAGCCATTATGGCCGGCCTTGTTGTCGTCGCCGGCATC
GTCTTCATTCCGCATGCGACTATAAACGCAGCCAGCCGGGTCGAAATGTCGGCCCATGGAACCAACTCATCGCCG
TTGTCGCGTCTTTCTATCGACTGGATCGGCGTAGTTCTCATCACTTCCGGGCTGATTGCTCTCATGTTCGCCCTT
ACCGAGGGCAGCGTGGTCGGCTGGCGCACACCATGGGTCCCGGTCACCATCATCGCGTCGTTGCTCGTCATCGCC
ATCTTCGTGCTATGGCAGTCCCGACTCGAACGCCTTCATGGCAGTCAGTGTGGCCACACCCCAAGCCTTCTGAGA
CCTCCGCCCCTCATAAAGGTATCCATCTTTCGTAATCTGCGCTTTAGTGCAGCTATAGTCATTATCGGCTTCTTC
TTTGCTTCTTTTGGCAGTTTTCTGGTTTACGCGACCTATTACTTCCAAGACTTTCAAGGTCTCTCTCCCCTTCAA
ACTATGCTACGATTTATTCCTACGGGCCTCGTAGGCGCCCTCATTACAGTCATCGTCGCCCAGCTTCTCGATCGG
GTTCCAACCTTCTATATCCTTGTCTGTGGAAACATCGCTGTCCCCATCGCGTCTCTGCTCTTCGCTGTCCCCATA
TCCCCAACTACGTCCTATTTTGCATACGGCCTGCCGGCCATGGTTCTCTGCGTTGTCGGGGCCGATACGATCTGG
CCCTGTCTTGGCCTCCTCATCTCCCAGGCCCTCCCGCCCGAGGACCAAGCCATGGGCGGCGCGCTCATCACTGCA
ATCGGCCAGTTTGGCCGCGCGATTGGGCTGGCTATCAGCACGTCGGTGCAGACAGCCGTTGTGGCTGGCGCCCGG
GGCATGCCCGTCGACACGGAGGAAGTGGGGCCGATCCGGCCCTGGGAGCCCGAGTCGCTCCGCGGTCTCCGAGCC
GCCAGCTGGACAAACTTTGGCTTTGGTGTAATCTCGCTTGCCATCGTCCTAGTTGCCTTTCGCAGTAGAGATATT
GTCGGGAAAACGACGTGCTCTAGTCTGGCTCAGGGGAGGCCAGACCCGGAAGAGGATGGAGAACGAAGGGTCTAG
Transcript >Hirsu2|1605
ATGGAGCCCTCGTCAGCCTCAGGTGAGGCGCTCCCTAGCAACACCGAAAAAAACGGACCGGTCTTTGTGAAGTCC
AGCTCCTATTCCTCAGACGATTTCAAGCATGCGGACCCCGATGGCCCTGGCCTGTCTCTTTCTCGAGCCCGGTCC
ATCGCCCTCGTAGCTACCGTTGCGGGTGGCTCCTTTCTTAATACGGCATCTATCCAAAGCGTTGTTATTATCCTG
CCCAGTATTGGCCGCGAGCTCTCCGTGCCAAACAGCCGGCAGCAATGGATCGTCTCATCATACTCGCTCGCCTTC
AGCTGCTTCCTGCTTTTCTGGGGCCGCGTTGCTGATATATACGGCAAGCGCCTCATCTTTATCCTCGGCTCTGTC
TGGGTCACCCTTATGATGGCTACTACCCCGTTTATGCCCAATGAAATTGCCTTTAACCTCTTCCGCGCTTTACAT
GGGCTGGGTGCTGCGGCCAACGTTCCGACGGCGATTGGCATTCTCGGCGTGACATTTCCACGTGGAAAGGCCCAG
AACTACGCCTTCAGTACCTACGCTGCGGGAGCTCCCCTCGGCAATGTGTTCGGGAACCTCATTTCGGGACTCATC
GCTCAGTACGCCAACTGGAGATGGGTGTTTGGTGTTTCAGCCATTATGGCCGGCCTTGTTGTCGTCGCCGGCATC
GTCTTCATTCCGCATGCGACTATAAACGCAGCCAGCCGGGTCGAAATGTCGGCCCATGGAACCAACTCATCGCCG
TTGTCGCGTCTTTCTATCGACTGGATCGGCGTAGTTCTCATCACTTCCGGGCTGATTGCTCTCATGTTCGCCCTT
ACCGAGGGCAGCGTGGTCGGCTGGCGCACACCATGGGTCCCGGTCACCATCATCGCGTCGTTGCTCGTCATCGCC
ATCTTCGTGCTATGGCAGTCCCGACTCGAACGCCTTCATGGCAGTCAGTGTGGCCACACCCCAAGCCTTCTGAGA
CCTCCGCCCCTCATAAAGGTATCCATCTTTCGTAATCTGCGCTTTAGTGCAGCTATAGTCATTATCGGCTTCTTC
TTTGCTTCTTTTGGCAGTTTTCTGGTTTACGCGACCTATTACTTCCAAGACTTTCAAGGTCTCTCTCCCCTTCAA
ACTATGCTACGATTTATTCCTACGGGCCTCGTAGGCGCCCTCATTACAGTCATCGTCGCCCAGCTTCTCGATCGG
GTTCCAACCTTCTATATCCTTGTCTGTGGAAACATCGCTGTCCCCATCGCGTCTCTGCTCTTCGCTGTCCCCATA
TCCCCAACTACGTCCTATTTTGCATACGGCCTGCCGGCCATGGTTCTCTGCGTTGTCGGGGCCGATACGATCTGG
CCCTGTCTTGGCCTCCTCATCTCCCAGGCCCTCCCGCCCGAGGACCAAGCCATGGGCGGCGCGCTCATCACTGCA
ATCGGCCAGTTTGGCCGCGCGATTGGGCTGGCTATCAGCACGTCGGTGCAGACAGCCGTTGTGGCTGGCGCCCGG
GGCATGCCCGTCGACACGGAGGAAGTGGGGCCGATCCGGCCCTGGGAGCCCGAGTCGCTCCGCGGTCTCCGAGCC
GCCAGCTGGACAAACTTTGGCTTTGGTGTAATCTCGCTTGCCATCGTCCTAGTTGCCTTTCGCAGTAGAGATATT
GTCGGGAAAACGACGTGCTCTAGTCTGGCTCAGGGGAGGCCAGACCCGGAAGAGGATGGAGAACGAAGGGTCTAG
Gene >Hirsu2|1605
ATGGAGCCCTCGTCAGCCTCAGGTGAGGCGCTCCCTAGCAACACCGAAAAAAACGGACCGGTCTTTGTGAAGTCC
AGCTCCTATTCCTCAGACGATTTCAAGCATGCGGACCCCGATGGCCCTGGCCTGTCTCTTTCTCGAGCCCGGTCC
ATCGCCCTCGTAGCTACCGTTGCGGGTGGCTCCTTTCTTAATGTTCGTATTCTCCTAGCCTAACCCCTTCCATCT
GATAACGGGGCTAATTCGTTCTGGCCCTCTATAACTGTAGACGGCATCTATCCAAAGCGTTGTTATTATCCTGCC
CAGTATTGGCCGCGAGCTCTCCGTGCCAAACAGCCGGCAGCAATGGATCGTCTCATCATACTCGCTCGCCTTCAG
CTGCTTCCTGCTTTTCTGGGGCCGCGTTGCTGATATATACGGCAAGCGCCTCATCTTTATCCTCGGCTCTGTCTG
GGTCACCCTTATGATGGCTACTACCCCGTTTATGCCCAATGAAATTGCCTTTAACCTCTTCCGCGCTTTACATGG
GCTGGTATGTCTGTCCTTGAGCTGTTCACTCTTTGCCTCTATCGCTTTTATGTTTTCTCAAGCGATACTGAAGGC
GCATGCTTGACTTCCACTACAGGACTGATACATGTAATCGCTATGATCCGGGCTTATAGGGTGCTGCGGCCAACG
TTCCGACGGCGATTGGCATTCTCGGCGTGACATTTCCACGTGGAAAGGCCCAGAACTACGCCTTCAGTACCTACG
GTCTGTTCTCAGTCTACCTCTCCACAACGCCGTGCTACAATTTGAACTGACTCCTCTTGCTTCTCTTGCTCGGCG
CAGCTGCGGGAGCTCCCCTCGGCAATGTGTTCGGGAACCTCATTTCGGGACTCATCGCTCAGTACGCCAACTGGA
GATGGGTGTTTGGTGTTTCAGCCATTATGGCCGGCCTTGTTGTCGTCGCCGGCATCGTCTTCATTCCGCATGCGA
CTATAAACGCAGCCAGCCGGGTCGAAATGTCGGCCCATGGAACCAACTCATCGCCGTTGTCGCGTCTTTCTATCG
ACTGGATCGGCGTAGTTCTCATCACTTCCGGGCTGATTGCTCTCATGTTCGCCCTTACCGAGGGCAGCGTGGTCG
GCTGGCGCACACCATGGGTCCCGGTCACCATCATCGCGTCGTTGCTCGTCATCGCCATCTTCGTGCTATGGCAGT
CCCGACTCGAACGCCTTCATGGCAGTCAGTGTGGCCACACCCCAAGCCTTCTGAGACCTCCGCCCCTCATAAAGG
TATCCATCTTTCGTAATCTGCGCTTTAGTGCAGCTATAGTCATTATCGGCTTCTTCTTTGCTTCTTTTGGCAGTT
TTCTGGTTTACGCGACCTATTACTTCCAAGACTTTCAAGGTCTCTCTCCCCTTCAAACTATGCTACGATTTATTC
CTACGGGCCTCGTAGGCGCCCTCATTACAGTCATCGTCGCCCAGCTTCTCGATCGGGTTCCAACCTTCTATATCC
TTGTCTGTGGAAACATCGCTGTCCCCATCGCGTCTCTGCTCTTCGCTGTCCCCATATCCCCAACTACGTCCTATT
TTGCATACGGCCTGCCGGCCATGGTTCTCTGCGTTGTCGGGGCCGATACGATCTGGCCCTGTCTTGGCCTCCTCA
TCTCCCAGGCCCTCCCGCCCGAGGACCAAGCCATGGGCGGCGCGCTCATCACTGCAATCGGCCAGTTTGGCCGCG
CGATTGGGCTGGCTATCAGCACGTCGGTGCAGACAGCCGTTGTGGCTGGCGCCCGGGGCATGCCCGTCGACACGG
AGGAAGTGGGGCCGATCCGGCCCTGGGAGCCCGAGTCGCTCCGCGGTCTCCGAGCCGCCAGCTGGACAAACTTTG
GCTTTGGTGTAATCTCGCTTGCCATCGTCCTAGTTGCCTTTCGCAGTAGAGATATTGTCGGGAAAACGACGTGCT
CTAGTCTGGCTCAGGGGAGGCCAGACCCGGAAGAGGATGGAGAACGAAGGGTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail