Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1604
Gene name
LocationContig_136:9341..10485
Strand-
Gene length (bp)1144
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.7E-16 4 260

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 5 339 1.0E-23
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 4 341 1.0E-22
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 9 341 9.0E-19
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 4 265 1.0E-18
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 2 287 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 5 339 1.0E-23
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 4 341 1.0E-22
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 9 341 9.0E-19
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 4 265 1.0E-18
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 2 287 3.0E-18
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 4 338 2.0E-17
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 4 198 3.0E-14
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 4 232 4.0E-14
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 5 111 7.0E-13
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 1 258 1.0E-12
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 5 320 6.0E-11
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 4 132 1.0E-10
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 4 340 6.0E-10
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 4 320 1.0E-07
sp|P0CF20|YO163_YEAST Putative uncharacterized transporter YOL163W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL163W PE=5 SV=1 9 121 6.0E-07
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 40 340 3.0E-06
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 4 265 5.0E-06
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 4 273 5.0E-06
sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.15c PE=3 SV=1 4 265 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 24 46 22
2 56 78 22
3 131 153 22
4 163 185 22
5 194 216 22
6 221 243 22
7 282 304 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1604
MEQPGCLYYLSCWYTRNELALRTACLYSGILASRAFSSLIAAAITVNMDGAGGLRGWRWLFLIEGIATIVISAIG
FFSMPDFPRNTTWLSEDEAVLAAWRLHEEVGKEDWTSGKGQPFWEGFWLVLTDVKTWLLAPILFGIMSASSVTSF
FPSAMGAFHHNQIATLLLLVPPYLFGIVVMLGNAWHADKTGERFYHITLPVCVAIVGFIIAAATTSTSARYASIM
LMVPGLYSGYTIALVWISNTLTRPPAKRAAGLAFIDSIAHSSNTYFTYMYPKSAAPAFSGAFVHNCVLAAVAIAG
AFALKVKLLRLNKQLEREELVEGTEKLSPEGTVNQGFRFLV*
Coding >Hirsu2|1604
ATGGAACAGCCCGGTTGTCTATACTACCTCAGTTGCTGGTACACGCGCAACGAGCTTGCACTTCGCACCGCCTGT
CTGTACAGCGGCATCCTGGCATCGCGCGCCTTCTCGAGCCTGATTGCGGCTGCCATCACCGTGAACATGGACGGC
GCCGGGGGCCTGCGCGGGTGGCGATGGCTTTTTCTGATCGAGGGAATCGCCACTATCGTCATCTCCGCCATCGGC
TTTTTCTCGATGCCTGACTTTCCGCGAAACACGACATGGCTGAGCGAGGATGAGGCAGTCCTCGCTGCCTGGAGG
CTCCACGAAGAGGTCGGCAAAGAGGACTGGACGAGCGGCAAGGGACAGCCGTTCTGGGAAGGCTTTTGGTTGGTC
TTGACAGACGTTAAGACGTGGCTCTTGGCCCCCATTCTCTTTGGAATCATGTCCGCATCGTCGGTGACCAGCTTC
TTCCCAAGCGCCATGGGAGCCTTCCACCACAACCAGATCGCCACACTGCTACTGCTGGTGCCCCCGTACCTGTTT
GGTATCGTCGTCATGCTCGGAAACGCATGGCATGCTGACAAGACCGGCGAGCGCTTCTACCACATAACGCTTCCC
GTCTGCGTGGCCATTGTAGGGTTCATCATCGCTGCCGCCACGACAAGCACCTCAGCTCGCTACGCGAGCATAATG
CTCATGGTTCCCGGGCTTTACAGCGGCTACACCATAGCGCTGGTTTGGATCAGCAACACCTTGACGCGTCCGCCT
GCCAAGCGGGCAGCCGGACTGGCCTTCATTGACTCCATCGCGCACAGCTCCAACACCTATTTCACTTATATGTAC
CCGAAATCGGCGGCGCCAGCATTCTCCGGCGCCTTTGTCCACAACTGTGTGCTGGCTGCGGTGGCTATCGCGGGA
GCTTTTGCGCTTAAAGTGAAGCTTCTGAGGCTGAACAAGCAGCTGGAGAGGGAGGAGCTGGTCGAGGGCACTGAA
AAATTATCACCTGAAGGGACGGTCAACCAGGGCTTCAGATTCCTTGTCTAA
Transcript >Hirsu2|1604
ATGGAACAGCCCGGTTGTCTATACTACCTCAGTTGCTGGTACACGCGCAACGAGCTTGCACTTCGCACCGCCTGT
CTGTACAGCGGCATCCTGGCATCGCGCGCCTTCTCGAGCCTGATTGCGGCTGCCATCACCGTGAACATGGACGGC
GCCGGGGGCCTGCGCGGGTGGCGATGGCTTTTTCTGATCGAGGGAATCGCCACTATCGTCATCTCCGCCATCGGC
TTTTTCTCGATGCCTGACTTTCCGCGAAACACGACATGGCTGAGCGAGGATGAGGCAGTCCTCGCTGCCTGGAGG
CTCCACGAAGAGGTCGGCAAAGAGGACTGGACGAGCGGCAAGGGACAGCCGTTCTGGGAAGGCTTTTGGTTGGTC
TTGACAGACGTTAAGACGTGGCTCTTGGCCCCCATTCTCTTTGGAATCATGTCCGCATCGTCGGTGACCAGCTTC
TTCCCAAGCGCCATGGGAGCCTTCCACCACAACCAGATCGCCACACTGCTACTGCTGGTGCCCCCGTACCTGTTT
GGTATCGTCGTCATGCTCGGAAACGCATGGCATGCTGACAAGACCGGCGAGCGCTTCTACCACATAACGCTTCCC
GTCTGCGTGGCCATTGTAGGGTTCATCATCGCTGCCGCCACGACAAGCACCTCAGCTCGCTACGCGAGCATAATG
CTCATGGTTCCCGGGCTTTACAGCGGCTACACCATAGCGCTGGTTTGGATCAGCAACACCTTGACGCGTCCGCCT
GCCAAGCGGGCAGCCGGACTGGCCTTCATTGACTCCATCGCGCACAGCTCCAACACCTATTTCACTTATATGTAC
CCGAAATCGGCGGCGCCAGCATTCTCCGGCGCCTTTGTCCACAACTGTGTGCTGGCTGCGGTGGCTATCGCGGGA
GCTTTTGCGCTTAAAGTGAAGCTTCTGAGGCTGAACAAGCAGCTGGAGAGGGAGGAGCTGGTCGAGGGCACTGAA
AAATTATCACCTGAAGGGACGGTCAACCAGGGCTTCAGATTCCTTGTCTAA
Gene >Hirsu2|1604
ATGGAACAGCCCGGTTGTCTATACTACCTCAGTTGCTGGTACACGCGCAACGAGCTTGCACTTCGCACCGCCTGT
CTGTACAGCGGCATCCTGGCATCGCGCGCCTTCTCGAGCCTGATTGCGGCTGCCATCACCGTGAACATGGACGGC
GCCGGGGGCCTGCGCGGGTGGCGATGGCTTTTTCTGATCGAGGGAATCGCCACTATCGTCATCTCCGCCATCGGC
TTTTTCTCGATGCCTGACTTTCCGCGAAACACGACATGGCTGAGCGAGGATGAGGCAGTCCTCGCTGCCTGGAGG
CTCCACGAAGAGGTCGGCAAAGAGGACTGGACGAGCGGCAAGGGACAGCCGTTCTGGGAAGGCTTTTGGTTGGTC
TTGACAGACGTTAAGACGTGGCTCTTGGTGAGTGCTCCTTGAGCAGAATCCCGTCTTCCAGCTAATGAGTCGTCG
AGGCCCCCATTCTCTTTGGAATCATGTCCGCATCGTCGGTGACCAGCTTCTTCCCAAGCGCCATGGGAGCCTTCC
ACCACAACCAGATCGCCACACTGCTACTGCTGGTGCCCCCGTACCTGTTTGGTATCGTCGTCATGCTCGGAAACG
CATGGCATGCTGACAAGACCGGCGAGCGCTTCTACCACATAACGCTTCCCGTCTGCGTGGCCATTGTAGGGTTCA
TCATCGCTGCCGCCACGACAAGCACCTCAGCTCGCTACGCGAGCATAATGCTCATGGTAAGCTTTGATCCGCGAG
AAGAAAAAAAAAGGTCGAAGCGAGCGTGGCCTGATGGACGTCTCTACAGGTTCCCGGGCTTTACAGCGGCTACAC
CATAGCGCTGGTTTGGATCAGCAACACCTTGACGCGTCCGCCTGCCAAGCGGGCAGCCGGACTGGCCTTCATTGA
CTCCATCGCGCACAGCTCCAACACCTATTTCACTTATATGTACCCGAAATCGGCGGCGCCAGCATTCTCCGGCGC
CTTTGTCCACAACTGTGTGCTGGCTGCGGTGGCTATCGCGGGAGCTTTTGCGCTTAAAGTGAAGCTTCTGAGGCT
GAACAAGCAGCTGGAGAGGGAGGAGCTGGTCGAGGGCACTGAAAAATTATCACCTGAAGGGACGGTCAACCAGGG
CTTCAGATTCCTTGTCTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail