Protein ID | Hirsu2|1603 |
Gene name | |
Location | Contig_136:2174..4675 |
Strand | - |
Gene length (bp) | 2501 |
Transcript length (bp) | 2442 |
Coding sequence length (bp) | 2442 |
Protein length (aa) | 814 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00122 | E1-E2_ATPase | E1-E2 ATPase | 2.2E-37 | 180 | 391 |
PF00702 | Hydrolase | haloacid dehalogenase-like hydrolase | 2.0E-15 | 411 | 768 |
PF13246 | Cation_ATPase | Cation transport ATPase (P-type) | 1.4E-15 | 485 | 573 |
PF00690 | Cation_ATPase_N | Cation transporter/ATPase, N-terminus | 1.4E-05 | 77 | 122 |
PF08282 | Hydrolase_3 | haloacid dehalogenase-like hydrolase | 5.5E-05 | 747 | 802 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q9HDW7|ATC2_SCHPO | Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 | 80 | 811 | 0.0E+00 |
sp|P54678|ATC1_DICDI | Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 | 32 | 811 | 9.0E-154 |
sp|P38929|ATC2_YEAST | Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 | 9 | 808 | 4.0E-153 |
sp|Q9R0K7|AT2B2_MOUSE | Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus GN=Atp2b2 PE=1 SV=2 | 55 | 811 | 3.0E-141 |
sp|Q64542|AT2B4_RAT | Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 | 75 | 811 | 1.0E-138 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q9HDW7|ATC2_SCHPO | Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 | 80 | 811 | 0.0E+00 |
sp|P54678|ATC1_DICDI | Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 | 32 | 811 | 9.0E-154 |
sp|P38929|ATC2_YEAST | Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 | 9 | 808 | 4.0E-153 |
sp|Q9R0K7|AT2B2_MOUSE | Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus GN=Atp2b2 PE=1 SV=2 | 55 | 811 | 3.0E-141 |
sp|Q64542|AT2B4_RAT | Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 | 75 | 811 | 1.0E-138 |
sp|P23634|AT2B4_HUMAN | Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2 | 32 | 811 | 7.0E-136 |
sp|D3K0R6|AT2B4_BOVIN | Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 | 75 | 811 | 3.0E-135 |
sp|Q65X71|ACA6_ORYSJ | Probable calcium-transporting ATPase 6, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os05g0495600 PE=3 SV=1 | 9 | 808 | 8.0E-135 |
sp|O22218|ACA4_ARATH | Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 | 82 | 808 | 4.0E-134 |
sp|Q9M2L4|ACA11_ARATH | Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 | 29 | 808 | 3.0E-131 |
sp|Q6Q477|AT2B4_MOUSE | Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus GN=Atp2b4 PE=1 SV=1 | 75 | 811 | 4.0E-131 |
sp|Q9SZR1|ACA10_ARATH | Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 | 26 | 808 | 9.0E-131 |
sp|Q2RAS0|ACA5_ORYSJ | Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 | 29 | 808 | 1.0E-127 |
sp|Q9LF79|ACA8_ARATH | Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 | 9 | 808 | 7.0E-126 |
sp|Q6ATV4|ACA2_ORYSJ | Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1 | 7 | 808 | 3.0E-125 |
sp|Q2QY12|ACA4_ORYSJ | Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1 | 9 | 808 | 8.0E-123 |
sp|Q37145|ACA1_ARATH | Calcium-transporting ATPase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=3 | 3 | 808 | 1.0E-122 |
sp|Q2QMX9|ACA1_ORYSJ | Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1 | 46 | 808 | 8.0E-121 |
sp|O81108|ACA2_ARATH | Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1 | 52 | 808 | 2.0E-120 |
sp|Q9LU41|ACA9_ARATH | Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 | 26 | 808 | 8.0E-120 |
sp|O64806|ACA7_ARATH | Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 | 61 | 808 | 2.0E-119 |
sp|Q8RUN1|ACA3_ORYSJ | Calcium-transporting ATPase 3, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os01g0939100 PE=2 SV=1 | 46 | 808 | 4.0E-115 |
sp|Q9LIK7|ACA13_ARATH | Putative calcium-transporting ATPase 13, plasma membrane-type OS=Arabidopsis thaliana GN=ACA13 PE=3 SV=1 | 26 | 811 | 4.0E-108 |
sp|Q9LY77|ACA12_ARATH | Calcium-transporting ATPase 12, plasma membrane-type OS=Arabidopsis thaliana GN=ACA12 PE=2 SV=1 | 26 | 811 | 8.0E-106 |
sp|Q16720|AT2B3_HUMAN | Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 | 301 | 811 | 6.0E-95 |
sp|Q01814|AT2B2_HUMAN | Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 | 303 | 811 | 4.0E-94 |
sp|Q64568|AT2B3_RAT | Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 | 301 | 811 | 5.0E-94 |
sp|P11506|AT2B2_RAT | Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 | 303 | 811 | 5.0E-94 |
sp|G5E829|AT2B1_MOUSE | Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 | 301 | 811 | 8.0E-94 |
sp|P11505|AT2B1_RAT | Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 | 301 | 811 | 9.0E-94 |
sp|P58165|AT2B2_OREMO | Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 | 301 | 811 | 4.0E-93 |
sp|P23220|AT2B1_PIG | Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 | 301 | 811 | 9.0E-91 |
sp|P20020|AT2B1_HUMAN | Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 | 301 | 811 | 1.0E-90 |
sp|Q00804|AT2B1_RABIT | Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 | 303 | 811 | 2.0E-87 |
sp|P13586|ATC1_YEAST | Calcium-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMR1 PE=1 SV=1 | 46 | 808 | 1.0E-76 |
sp|P37278|ATCL_SYNE7 | Calcium-transporting ATPase OS=Synechococcus elongatus (strain PCC 7942) GN=pacL PE=1 SV=2 | 76 | 813 | 9.0E-74 |
sp|Q9CFU9|LLCA1_LACLA | Calcium-transporting ATPase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yoaB PE=1 SV=1 | 89 | 811 | 6.0E-73 |
sp|Q73E41|BACA1_BACC1 | Calcium-transporting ATPase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0519 PE=1 SV=1 | 80 | 808 | 1.0E-72 |
sp|P37367|ATA1_SYNY3 | Cation-transporting ATPase pma1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pma1 PE=3 SV=2 | 80 | 813 | 1.0E-71 |
sp|P78036|ATCL_MYCPN | Probable cation-transporting P-type ATPase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pacL PE=3 SV=1 | 76 | 806 | 2.0E-71 |
sp|Q8Y8Q5|LMCA1_LISMO | Calcium-transporting ATPase lmo0841 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0841 PE=1 SV=1 | 81 | 811 | 5.0E-70 |
sp|P57709|AT2C1_BOVIN | Calcium-transporting ATPase type 2C member 1 OS=Bos taurus GN=ATP2C1 PE=2 SV=1 | 41 | 811 | 3.0E-68 |
sp|O34431|ATCL_BACSU | Calcium-transporting ATPase OS=Bacillus subtilis (strain 168) GN=yloB PE=1 SV=1 | 51 | 813 | 9.0E-68 |
sp|P98194|AT2C1_HUMAN | Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens GN=ATP2C1 PE=1 SV=3 | 41 | 811 | 5.0E-67 |
sp|P92939|ECA1_ARATH | Calcium-transporting ATPase 1, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA1 PE=1 SV=2 | 81 | 813 | 8.0E-67 |
sp|O43108|ATC1_YARLI | Calcium-transporting ATPase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PMR1 PE=3 SV=1 | 148 | 813 | 2.0E-66 |
sp|Q9XES1|ECA4_ARATH | Calcium-transporting ATPase 4, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA4 PE=2 SV=2 | 81 | 813 | 4.0E-66 |
sp|Q5R5K5|AT2C1_PONAB | Calcium-transporting ATPase type 2C member 1 OS=Pongo abelii GN=ATP2C1 PE=2 SV=1 | 41 | 811 | 7.0E-66 |
sp|P9WPS9|CTPF_MYCTU | Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpF PE=1 SV=1 | 80 | 811 | 1.0E-65 |
sp|P9WPS8|CTPF_MYCTO | Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpF PE=2 SV=1 | 80 | 811 | 1.0E-65 |
sp|P63688|CTPF_MYCBO | Probable cation-transporting ATPase F OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpF PE=3 SV=1 | 80 | 811 | 1.0E-65 |
sp|P47317|ATCL_MYCGE | Probable cation-transporting P-type ATPase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pacL PE=3 SV=1 | 142 | 806 | 1.0E-65 |
sp|Q64566|AT2C1_RAT | Calcium-transporting ATPase type 2C member 1 OS=Rattus norvegicus GN=Atp2c1 PE=2 SV=1 | 103 | 811 | 8.0E-65 |
sp|P54209|ATC1_DUNBI | Cation-transporting ATPase CA1 OS=Dunaliella bioculata GN=CA1 PE=2 SV=1 | 81 | 813 | 1.0E-64 |
sp|Q6RWA9|AT1A_TAESO | Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium PE=2 SV=1 | 74 | 811 | 1.0E-64 |
sp|O59868|ATC1_SCHPO | Calcium-transporting ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmr1 PE=1 SV=1 | 46 | 808 | 2.0E-64 |
sp|Q92126|ATP4A_XENLA | Potassium-transporting ATPase alpha chain 1 OS=Xenopus laevis GN=atp4a PE=2 SV=3 | 89 | 811 | 2.0E-64 |
sp|O23087|ECA2_ARATH | Calcium-transporting ATPase 2, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA2 PE=1 SV=1 | 41 | 813 | 2.0E-64 |
sp|P35315|ATC_TRYBB | Probable calcium-transporting ATPase OS=Trypanosoma brucei brucei GN=TBA1 PE=3 SV=1 | 81 | 813 | 6.0E-64 |
sp|P13607|ATNA_DROME | Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster GN=Atpalpha PE=1 SV=3 | 92 | 811 | 7.0E-64 |
sp|Q42883|ECAP_SOLLC | Calcium-transporting ATPase, endoplasmic reticulum-type OS=Solanum lycopersicum GN=LCA1 PE=2 SV=1 | 81 | 813 | 5.0E-63 |
sp|P58312|AT1A3_OREMO | Sodium/potassium-transporting ATPase subunit alpha-3 OS=Oreochromis mossambicus GN=atp1a3 PE=2 SV=1 | 92 | 811 | 6.0E-62 |
sp|P54708|AT12A_RAT | Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus GN=Atp12a PE=1 SV=1 | 92 | 811 | 1.0E-60 |
sp|P50993|AT1A2_HUMAN | Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens GN=ATP1A2 PE=1 SV=1 | 92 | 811 | 1.0E-60 |
sp|P06686|AT1A2_RAT | Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus GN=Atp1a2 PE=1 SV=1 | 92 | 811 | 3.0E-60 |
sp|Q6PIE5|AT1A2_MOUSE | Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus GN=Atp1a2 PE=1 SV=1 | 92 | 811 | 3.0E-60 |
sp|A2VDL6|AT1A2_BOVIN | Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus GN=ATP1A2 PE=2 SV=1 | 92 | 811 | 3.0E-60 |
sp|Q9WV27|AT1A4_MOUSE | Sodium/potassium-transporting ATPase subunit alpha-4 OS=Mus musculus GN=Atp1a4 PE=1 SV=3 | 92 | 811 | 5.0E-60 |
sp|Q8R4C1|AT2C2_RAT | Calcium-transporting ATPase type 2C member 2 OS=Rattus norvegicus GN=Atp2c2 PE=2 SV=1 | 103 | 808 | 6.0E-60 |
sp|P24798|AT1A3_CHICK | Sodium/potassium-transporting ATPase subunit alpha-3 OS=Gallus gallus GN=ATP1A3 PE=2 SV=1 | 92 | 811 | 6.0E-60 |
sp|Q13733|AT1A4_HUMAN | Sodium/potassium-transporting ATPase subunit alpha-4 OS=Homo sapiens GN=ATP1A4 PE=1 SV=3 | 186 | 811 | 8.0E-60 |
sp|Q9TV52|AT12A_RABIT | Potassium-transporting ATPase alpha chain 2 OS=Oryctolagus cuniculus GN=ATP12A PE=2 SV=1 | 92 | 811 | 1.0E-59 |
sp|D2WKD8|AT1A2_PIG | Sodium/potassium-transporting ATPase subunit alpha-2 OS=Sus scrofa GN=ATP1A2 PE=1 SV=1 | 92 | 811 | 1.0E-59 |
sp|Q80XR2|AT2C1_MOUSE | Calcium-transporting ATPase type 2C member 1 OS=Mus musculus GN=Atp2c1 PE=1 SV=2 | 103 | 811 | 1.0E-59 |
sp|P35317|AT1A_HYDVU | Sodium/potassium-transporting ATPase subunit alpha OS=Hydra vulgaris PE=2 SV=1 | 46 | 811 | 1.0E-59 |
sp|P17326|AT1A_ARTSF | Sodium/potassium-transporting ATPase subunit alpha-A OS=Artemia franciscana PE=2 SV=1 | 92 | 811 | 2.0E-59 |
sp|Q9YGL9|AT2A3_CHICK | Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Gallus gallus GN=ATP2A3 PE=2 SV=1 | 83 | 813 | 2.0E-59 |
sp|Q9Z1W8|AT12A_MOUSE | Potassium-transporting ATPase alpha chain 2 OS=Mus musculus GN=Atp12a PE=1 SV=3 | 92 | 811 | 3.0E-59 |
sp|Q64541|AT1A4_RAT | Sodium/potassium-transporting ATPase subunit alpha-4 OS=Rattus norvegicus GN=Atp1a4 PE=2 SV=1 | 92 | 811 | 3.0E-59 |
sp|Q64518|AT2A3_MOUSE | Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Mus musculus GN=Atp2a3 PE=1 SV=3 | 83 | 813 | 1.0E-58 |
sp|A7L9Z8|AT2C2_MOUSE | Calcium-transporting ATPase type 2C member 2 OS=Mus musculus GN=Atp2c2 PE=2 SV=1 | 103 | 808 | 1.0E-58 |
sp|Q9YH26|AT1A1_OREMO | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oreochromis mossambicus GN=atp1a1 PE=2 SV=2 | 92 | 811 | 1.0E-58 |
sp|P13637|AT1A3_HUMAN | Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens GN=ATP1A3 PE=1 SV=3 | 92 | 811 | 2.0E-58 |
sp|P05025|AT1A_TORCA | Sodium/potassium-transporting ATPase subunit alpha OS=Torpedo californica PE=1 SV=1 | 92 | 811 | 2.0E-58 |
sp|Q5RDR3|AT1A1_PONAB | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Pongo abelii GN=ATP1A1 PE=2 SV=1 | 92 | 811 | 2.0E-58 |
sp|Q5RCD8|AT1A2_PONAB | Sodium/potassium-transporting ATPase subunit alpha-2 OS=Pongo abelii GN=ATP1A2 PE=2 SV=1 | 92 | 811 | 3.0E-58 |
sp|Q64392|AT12A_CAVPO | Potassium-transporting ATPase alpha chain 2 OS=Cavia porcellus GN=ATP12A PE=2 SV=1 | 92 | 811 | 4.0E-58 |
sp|P06687|AT1A3_RAT | Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus GN=Atp1a3 PE=1 SV=2 | 92 | 811 | 4.0E-58 |
sp|Q6PIC6|AT1A3_MOUSE | Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus GN=Atp1a3 PE=1 SV=1 | 92 | 811 | 4.0E-58 |
sp|Q93084|AT2A3_HUMAN | Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Homo sapiens GN=ATP2A3 PE=1 SV=2 | 83 | 808 | 5.0E-58 |
sp|P18907|AT1A1_HORSE | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Equus caballus GN=ATP1A1 PE=3 SV=1 | 92 | 811 | 5.0E-58 |
sp|P05023|AT1A1_HUMAN | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1 | 92 | 811 | 6.0E-58 |
sp|P18596|AT2A3_RAT | Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Rattus norvegicus GN=Atp2a3 PE=1 SV=2 | 83 | 813 | 8.0E-58 |
sp|P24797|AT1A2_CHICK | Sodium/potassium-transporting ATPase subunit alpha-2 OS=Gallus gallus GN=ATP1A2 PE=2 SV=1 | 92 | 811 | 1.0E-57 |
sp|P20648|ATP4A_HUMAN | Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens GN=ATP4A PE=2 SV=5 | 65 | 811 | 1.0E-57 |
sp|P09626|ATP4A_RAT | Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus GN=Atp4a PE=1 SV=3 | 65 | 811 | 1.0E-57 |
sp|Q64436|ATP4A_MOUSE | Potassium-transporting ATPase alpha chain 1 OS=Mus musculus GN=Atp4a PE=1 SV=3 | 186 | 811 | 1.0E-57 |
sp|P19156|ATP4A_PIG | Potassium-transporting ATPase alpha chain 1 OS=Sus scrofa GN=ATP4A PE=1 SV=3 | 76 | 811 | 2.0E-57 |
sp|P54707|AT12A_HUMAN | Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens GN=ATP12A PE=1 SV=3 | 92 | 811 | 3.0E-57 |
sp|P28774|AT1B_ARTSF | Sodium/potassium-transporting ATPase subunit alpha-B OS=Artemia franciscana PE=2 SV=1 | 92 | 811 | 3.0E-57 |
sp|P27112|ATP4A_RABIT | Potassium-transporting ATPase alpha chain 1 OS=Oryctolagus cuniculus GN=ATP4A PE=2 SV=3 | 92 | 811 | 3.0E-57 |
sp|P50997|AT1A1_CANLF | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Canis lupus familiaris GN=ATP1A1 PE=2 SV=1 | 92 | 811 | 8.0E-57 |
sp|P05024|AT1A1_PIG | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa GN=ATP1A1 PE=1 SV=1 | 92 | 811 | 1.0E-56 |
sp|Q8VDN2|AT1A1_MOUSE | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus GN=Atp1a1 PE=1 SV=1 | 92 | 811 | 1.0E-56 |
sp|P04074|AT1A1_SHEEP | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Ovis aries GN=ATP1A1 PE=1 SV=1 | 92 | 811 | 1.0E-56 |
sp|P06685|AT1A1_RAT | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus GN=Atp1a1 PE=1 SV=1 | 92 | 811 | 2.0E-56 |
sp|Q08DA1|AT1A1_BOVIN | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Bos taurus GN=ATP1A1 PE=2 SV=1 | 92 | 811 | 2.0E-56 |
sp|Q9N0Z6|AT1A1_RABIT | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oryctolagus cuniculus GN=ATP1A1 PE=1 SV=2 | 150 | 811 | 2.0E-56 |
sp|P25489|AT1A1_CATCO | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Catostomus commersonii GN=atp1a1 PE=2 SV=1 | 92 | 811 | 3.0E-56 |
sp|P50996|ATP4A_CANLF | Potassium-transporting ATPase alpha chain 1 OS=Canis lupus familiaris GN=ATP4A PE=2 SV=3 | 92 | 811 | 5.0E-56 |
sp|P30714|AT1A1_RHIMB | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rhinella marina GN=ATP1A1 PE=1 SV=2 | 92 | 811 | 7.0E-56 |
sp|Q92123|AT1A1_XENLA | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Xenopus laevis GN=atp1a1 PE=2 SV=1 | 92 | 811 | 2.0E-55 |
sp|Q92030|AT1A1_ANGAN | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Anguilla anguilla GN=atp1a1 PE=2 SV=1 | 92 | 811 | 3.0E-55 |
sp|O75185|AT2C2_HUMAN | Calcium-transporting ATPase type 2C member 2 OS=Homo sapiens GN=ATP2C2 PE=1 SV=2 | 143 | 808 | 5.0E-55 |
sp|Q9SY55|ECA3_ARATH | Calcium-transporting ATPase 3, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA3 PE=2 SV=3 | 81 | 813 | 2.0E-54 |
sp|P09572|AT1A1_CHICK | Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus GN=ATP1A1 PE=2 SV=1 | 150 | 811 | 2.0E-54 |
sp|Q92036|AT12A_RHIMB | Potassium-transporting ATPase alpha chain 2 OS=Rhinella marina GN=ATP12A PE=2 SV=1 | 186 | 811 | 3.0E-54 |
sp|Q7PPA5|ATC1_ANOGA | Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Anopheles gambiae GN=Ca-P60A PE=3 SV=5 | 81 | 813 | 1.0E-53 |
sp|P22189|ATC3_SCHPO | Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 | 143 | 811 | 2.0E-53 |
sp|O46674|AT2A2_CANLF | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Canis lupus familiaris GN=ATP2A2 PE=2 SV=1 | 83 | 813 | 7.0E-53 |
sp|P22700|ATC1_DROME | Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster GN=Ca-P60A PE=1 SV=2 | 82 | 813 | 9.0E-53 |
sp|O55143|AT2A2_MOUSE | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Mus musculus GN=Atp2a2 PE=1 SV=2 | 83 | 813 | 1.0E-52 |
sp|P16615|AT2A2_HUMAN | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 | 83 | 813 | 1.0E-52 |
sp|P70083|AT2A1_MAKNI | Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Makaira nigricans GN=atp2a1 PE=2 SV=2 | 79 | 813 | 1.0E-52 |
sp|P11607|AT2A2_PIG | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Sus scrofa GN=ATP2A2 PE=1 SV=1 | 83 | 813 | 1.0E-52 |
sp|Q292Q0|ATC1_DROPS | Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila pseudoobscura pseudoobscura GN=Ca-P60A PE=3 SV=2 | 85 | 813 | 2.0E-52 |
sp|Q92105|AT2A1_PELES | Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Pelophylax esculentus GN=ATP2A1 PE=2 SV=1 | 85 | 813 | 2.0E-52 |
sp|Q00779|AT2A2_FELCA | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Felis catus GN=ATP2A2 PE=2 SV=1 | 83 | 813 | 2.0E-52 |
sp|P11507|AT2A2_RAT | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Rattus norvegicus GN=Atp2a2 PE=1 SV=1 | 83 | 813 | 2.0E-52 |
sp|P35316|ATC_ARTSF | Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Artemia franciscana PE=2 SV=1 | 81 | 813 | 3.0E-52 |
sp|P20647|AT2A2_RABIT | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Oryctolagus cuniculus GN=ATP2A2 PE=2 SV=2 | 83 | 813 | 3.0E-52 |
sp|O14983|AT2A1_HUMAN | Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens GN=ATP2A1 PE=1 SV=1 | 89 | 813 | 1.0E-51 |
sp|P13585|AT2A1_CHICK | Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Gallus gallus GN=ATP2A1 PE=2 SV=2 | 78 | 813 | 2.0E-51 |
sp|Q12691|ATN5_YEAST | Sodium transport ATPase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA5 PE=1 SV=1 | 143 | 811 | 2.0E-51 |
sp|Q01896|ATN2_YEAST | Sodium transport ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA2 PE=1 SV=1 | 143 | 811 | 3.0E-51 |
sp|Q64578|AT2A1_RAT | Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Rattus norvegicus GN=Atp2a1 PE=1 SV=1 | 84 | 813 | 3.0E-51 |
sp|Q03669|AT2A2_CHICK | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Gallus gallus GN=ATP2A2 PE=2 SV=2 | 83 | 813 | 3.0E-51 |
sp|P04191|AT2A1_RABIT | Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Oryctolagus cuniculus GN=ATP2A1 PE=1 SV=1 | 84 | 813 | 4.0E-51 |
sp|Q8R429|AT2A1_MOUSE | Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Mus musculus GN=Atp2a1 PE=1 SV=1 | 84 | 813 | 5.0E-51 |
sp|Q0VCY0|AT2A1_BOVIN | Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Bos taurus GN=ATP2A1 PE=1 SV=1 | 84 | 813 | 1.0E-50 |
sp|P13587|ATN1_YEAST | Sodium transport ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA1 PE=1 SV=1 | 143 | 811 | 1.0E-50 |
sp|P0ABB8|ATMA_ECOLI | Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli (strain K12) GN=mgtA PE=1 SV=1 | 83 | 806 | 2.0E-40 |
sp|P0ABB9|ATMA_ECO57 | Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli O157:H7 GN=mgtA PE=3 SV=1 | 83 | 806 | 2.0E-40 |
sp|O53114|CTPI_MYCLE | Probable cation-transporting ATPase I OS=Mycobacterium leprae (strain TN) GN=ctpI PE=3 SV=1 | 176 | 808 | 4.0E-40 |
sp|Q64568|AT2B3_RAT | Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 | 81 | 295 | 7.0E-39 |
sp|Q16720|AT2B3_HUMAN | Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 | 81 | 295 | 5.0E-38 |
sp|Q58623|Y1226_METJA | Putative cation-transporting ATPase MJ1226 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1226 PE=3 SV=1 | 81 | 773 | 6.0E-38 |
sp|P9WPS4|CTPI_MYCTO | Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 | 176 | 808 | 1.0E-37 |
sp|Q01814|AT2B2_HUMAN | Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 | 55 | 295 | 6.0E-37 |
sp|Q08853|ATC_PLAFK | Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 | 520 | 813 | 7.0E-37 |
sp|P11506|AT2B2_RAT | Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 | 55 | 295 | 1.0E-36 |
sp|P58165|AT2B2_OREMO | Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 | 34 | 295 | 2.0E-36 |
sp|P28877|PMA1_CANAX | Plasma membrane ATPase 1 OS=Candida albicans GN=PMA1 PE=1 SV=1 | 81 | 808 | 3.0E-33 |
sp|Q9LY32|PMA7_ARATH | ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=AHA7 PE=2 SV=1 | 81 | 808 | 4.0E-33 |
sp|P54679|PMA1_DICDI | Probable plasma membrane ATPase OS=Dictyostelium discoideum GN=patB PE=2 SV=2 | 80 | 808 | 6.0E-32 |
sp|P07038|PMA1_NEUCR | Plasma membrane ATPase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pma-1 PE=1 SV=1 | 81 | 808 | 7.0E-31 |
sp|P19657|PMA2_YEAST | Plasma membrane ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA2 PE=1 SV=3 | 80 | 808 | 1.0E-30 |
sp|P05030|PMA1_YEAST | Plasma membrane ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA1 PE=1 SV=2 | 59 | 808 | 1.0E-30 |
sp|Q9M2A0|PMA8_ARATH | ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=AHA8 PE=3 SV=1 | 80 | 808 | 5.0E-30 |
sp|Q00804|AT2B1_RABIT | Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 | 30 | 295 | 2.0E-29 |
sp|P23220|AT2B1_PIG | Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 | 81 | 295 | 5.0E-29 |
sp|P20020|AT2B1_HUMAN | Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 | 34 | 295 | 5.0E-29 |
sp|G5E829|AT2B1_MOUSE | Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 | 34 | 295 | 6.0E-29 |
sp|P11505|AT2B1_RAT | Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 | 34 | 295 | 6.0E-29 |
sp|Q43128|PMA10_ARATH | ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=AHA10 PE=2 SV=2 | 81 | 808 | 9.0E-29 |
sp|Q9SH76|PMA6_ARATH | ATPase 6, plasma membrane-type OS=Arabidopsis thaliana GN=AHA6 PE=2 SV=1 | 82 | 808 | 4.0E-28 |
sp|P54210|PMA1_DUNAC | Plasma membrane ATPase OS=Dunaliella acidophila GN=DHA1 PE=2 SV=1 | 149 | 808 | 4.0E-27 |
sp|Q9SU58|PMA4_ARATH | ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=AHA4 PE=2 SV=2 | 81 | 808 | 4.0E-27 |
sp|P49380|PMA1_KLULA | Plasma membrane ATPase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PMA1 PE=1 SV=1 | 66 | 808 | 4.0E-27 |
sp|P24545|PMA1_ZYGRO | Plasma membrane ATPase OS=Zygosaccharomyces rouxii PE=3 SV=1 | 82 | 808 | 8.0E-26 |
sp|Q9NQ11|AT132_HUMAN | Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 | 155 | 788 | 2.0E-25 |
sp|Q08435|PMA1_NICPL | Plasma membrane ATPase 1 OS=Nicotiana plumbaginifolia GN=PMA1 PE=2 SV=1 | 185 | 808 | 2.0E-25 |
sp|Q07421|PMA1_AJECA | Plasma membrane ATPase OS=Ajellomyces capsulatus GN=PMA1 PE=3 SV=1 | 59 | 775 | 2.0E-25 |
sp|Q9SJB3|PMA5_ARATH | ATPase 5, plasma membrane-type OS=Arabidopsis thaliana GN=AHA5 PE=3 SV=3 | 80 | 808 | 5.0E-25 |
sp|P9WPS5|CTPI_MYCTU | Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 | 529 | 808 | 6.0E-25 |
sp|Q9CTG6|AT132_MOUSE | Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 | 198 | 788 | 7.0E-24 |
sp|Q08853|ATC_PLAFK | Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 | 81 | 417 | 8.0E-23 |
sp|Q03194|PMA4_NICPL | Plasma membrane ATPase 4 OS=Nicotiana plumbaginifolia GN=PMA4 PE=2 SV=1 | 200 | 808 | 2.0E-22 |
sp|Q4VNC0|AT135_HUMAN | Probable cation-transporting ATPase 13A5 OS=Homo sapiens GN=ATP13A5 PE=2 SV=1 | 148 | 773 | 6.0E-22 |
sp|P98205|ALA2_ARATH | Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 | 154 | 785 | 1.0E-21 |
sp|Q42556|PMA9_ARATH | ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=AHA9 PE=2 SV=2 | 185 | 808 | 3.0E-21 |
sp|Q7XPY2|PMA1_ORYSJ | Plasma membrane ATPase OS=Oryza sativa subsp. japonica GN=Os04g0656100 PE=2 SV=1 | 200 | 808 | 3.0E-21 |
sp|P22036|ATMB_SALTY | Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtB PE=1 SV=3 | 80 | 424 | 4.0E-21 |
sp|P20431|PMA3_ARATH | ATPase 3, plasma membrane-type OS=Arabidopsis thaliana GN=AHA3 PE=1 SV=2 | 185 | 808 | 4.0E-21 |
sp|Q4VNC1|AT134_HUMAN | Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 | 188 | 773 | 6.0E-21 |
sp|Q08436|PMA3_NICPL | Plasma membrane ATPase 3 OS=Nicotiana plumbaginifolia GN=PMA3 PE=1 SV=1 | 81 | 808 | 1.0E-20 |
sp|P22180|PMA1_SOLLC | Plasma membrane ATPase 1 OS=Solanum lycopersicum GN=LHA1 PE=2 SV=1 | 81 | 808 | 2.0E-20 |
sp|O43520|AT8B1_HUMAN | Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 | 173 | 698 | 4.0E-20 |
sp|P19456|PMA2_ARATH | ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=AHA2 PE=1 SV=2 | 185 | 808 | 7.0E-20 |
sp|P83970|PMA1_WHEAT | Plasma membrane ATPase OS=Triticum aestivum GN=ha1 PE=2 SV=1 | 80 | 808 | 1.0E-19 |
sp|P36640|ATMA_SALTY | Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtA PE=2 SV=1 | 70 | 430 | 1.0E-19 |
sp|D0ZTB2|ATMA_SALT1 | Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=mgtA PE=2 SV=1 | 70 | 430 | 1.0E-19 |
sp|Q21286|YBF7_CAEEL | Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 | 195 | 774 | 2.0E-19 |
sp|Q9SX33|ALA9_ARATH | Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 | 61 | 736 | 6.0E-19 |
sp|Q5XF89|AT133_MOUSE | Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 | 198 | 697 | 8.0E-19 |
sp|O14072|ATC4_SCHPO | Manganese-transporting ATPase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta4 PE=3 SV=1 | 151 | 773 | 1.0E-18 |
sp|Q3TYU2|AT135_MOUSE | Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 | 148 | 773 | 2.0E-18 |
sp|Q5ZKB7|AT134_CHICK | Probable cation-transporting ATPase 13A4 OS=Gallus gallus GN=ATP13A4 PE=2 SV=1 | 199 | 773 | 3.0E-18 |
sp|P9WPS5|CTPI_MYCTU | Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 | 176 | 454 | 4.0E-18 |
sp|Q5XF90|AT134_MOUSE | Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 | 200 | 773 | 9.0E-18 |
sp|Q148W0|AT8B1_MOUSE | Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 | 173 | 698 | 1.0E-17 |
sp|P39524|ATC3_YEAST | Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 | 86 | 785 | 5.0E-17 |
sp|O74431|ATC9_SCHPO | Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.11c PE=3 SV=1 | 144 | 697 | 6.0E-17 |
sp|P22036|ATMB_SALTY | Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtB PE=1 SV=3 | 533 | 806 | 8.0E-17 |
sp|P40527|ATC7_YEAST | Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 | 193 | 806 | 9.0E-17 |
sp|Q12675|ATC4_YEAST | Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 | 202 | 780 | 1.0E-16 |
sp|P98195|ATP9B_MOUSE | Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 | 178 | 782 | 1.0E-16 |
sp|P70704|AT8A1_MOUSE | Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 | 151 | 789 | 1.0E-16 |
sp|D4ABB8|ATP9B_RAT | Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 | 178 | 782 | 2.0E-16 |
sp|Q8R8I6|KDPB_CALS4 | Potassium-transporting ATPase ATP-binding subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=kdpB PE=3 SV=1 | 576 | 806 | 3.0E-16 |
sp|Q9GKS6|AT10D_MACFA | Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 | 487 | 780 | 4.0E-16 |
sp|P54211|PMA1_DUNBI | Plasma membrane ATPase OS=Dunaliella bioculata GN=PMA1 PE=2 SV=1 | 80 | 426 | 4.0E-16 |
sp|P73241|ATCS_SYNY3 | Probable copper-transporting ATPase PacS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pacS PE=1 SV=1 | 642 | 807 | 4.0E-16 |
sp|B4U8E4|KDPB_HYDS0 | Potassium-transporting ATPase ATP-binding subunit OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=kdpB PE=3 SV=1 | 579 | 808 | 5.0E-16 |
sp|O43861|ATP9B_HUMAN | Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 | 370 | 782 | 7.0E-16 |
sp|O94296|YOOC_SCHPO | Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 | 65 | 785 | 9.0E-16 |
sp|Q12697|YPK9_YEAST | Vacuolar cation-transporting ATPase YPK9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK9 PE=1 SV=1 | 143 | 807 | 2.0E-15 |
sp|Q9LV11|PMA11_ARATH | ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=AHA11 PE=1 SV=1 | 81 | 426 | 2.0E-15 |
sp|P20649|PMA1_ARATH | ATPase 1, plasma membrane-type OS=Arabidopsis thaliana GN=AHA1 PE=1 SV=3 | 185 | 426 | 2.0E-15 |
sp|Q6UQ17|AT8B3_MOUSE | Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 | 102 | 698 | 2.0E-15 |
sp|P12522|ATXB_LEIDO | Probable proton ATPase 1B OS=Leishmania donovani GN=H1B PE=2 SV=1 | 73 | 426 | 2.0E-15 |
sp|P36640|ATMA_SALTY | Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtA PE=2 SV=1 | 530 | 806 | 3.0E-15 |
sp|D0ZTB2|ATMA_SALT1 | Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=mgtA PE=2 SV=1 | 530 | 806 | 3.0E-15 |
sp|Q9Y2Q0|AT8A1_HUMAN | Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 | 151 | 789 | 3.0E-15 |
sp|P11718|ATXA_LEIDO | Probable proton ATPase 1A OS=Leishmania donovani GN=H1A PE=2 SV=2 | 73 | 426 | 3.0E-15 |
sp|Q29449|AT8A1_BOVIN | Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 | 151 | 789 | 4.0E-15 |
sp|C7EXK4|AT8A2_BOVIN | Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 | 85 | 789 | 5.0E-15 |
sp|Q9U280|TAT1_CAEEL | Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 | 81 | 782 | 6.0E-15 |
sp|P98200|AT8A2_MOUSE | Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 | 151 | 789 | 6.0E-15 |
sp|Q27533|YH2M_CAEEL | Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans GN=W08D2.5 PE=3 SV=2 | 110 | 701 | 9.0E-15 |
sp|Q9NTI2|AT8A2_HUMAN | Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 | 151 | 789 | 9.0E-15 |
sp|Q9LK90|ALA8_ARATH | Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 | 370 | 760 | 1.0E-14 |
sp|P98198|AT8B2_HUMAN | Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 | 335 | 698 | 1.0E-14 |
sp|P35597|EXP7_STRPN | Probable cation-transporting ATPase exp7 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp7 PE=3 SV=2 | 645 | 808 | 1.0E-14 |
sp|P09627|PMA1_SCHPO | Plasma membrane ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma1 PE=1 SV=1 | 81 | 426 | 1.0E-14 |
sp|Q9P241|AT10D_HUMAN | Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 | 487 | 697 | 2.0E-14 |
sp|Q9RZP0|KDPB_DEIRA | Potassium-transporting ATPase ATP-binding subunit OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=kdpB PE=3 SV=1 | 641 | 808 | 5.0E-14 |
sp|Q9KPZ7|COPA_VIBCH | Copper-exporting P-type ATPase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=copA PE=3 SV=1 | 582 | 807 | 6.0E-14 |
sp|P98199|AT8B2_MOUSE | Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 | 336 | 698 | 6.0E-14 |
sp|A7GLG4|KDPB_BACCN | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=kdpB PE=3 SV=1 | 651 | 808 | 7.0E-14 |
sp|Q9X5V3|ATCU_RHILV | Copper-transporting P-type ATPase OS=Rhizobium leguminosarum bv. viciae GN=actP PE=1 SV=1 | 642 | 801 | 7.0E-14 |
sp|Q97BF6|KDPB_THEVO | Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=kdpB PE=3 SV=1 | 642 | 808 | 9.0E-14 |
sp|Q5BL50|AT8B1_XENTR | Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 | 84 | 697 | 1.0E-13 |
sp|P9WPU3|KDPB_MYCTU | Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdpB PE=3 SV=1 | 624 | 806 | 2.0E-13 |
sp|P9WPU2|KDPB_MYCTO | Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdpB PE=3 SV=1 | 624 | 806 | 2.0E-13 |
sp|P63682|KDPB_MYCBO | Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kdpB PE=3 SV=1 | 624 | 806 | 2.0E-13 |
sp|Q9T0E0|PMAX_ARATH | Putative ATPase, plasma membrane-like OS=Arabidopsis thaliana GN=At4g11730 PE=3 SV=1 | 81 | 426 | 2.0E-13 |
sp|Q9SAF5|ALA11_ARATH | Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 | 348 | 697 | 2.0E-13 |
sp|P57700|KDPB_THEAC | Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=kdpB PE=3 SV=1 | 642 | 808 | 2.0E-13 |
sp|Q9A7X7|KDPB_CAUCR | Potassium-transporting ATPase ATP-binding subunit OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=kdpB PE=3 SV=1 | 560 | 806 | 2.0E-13 |
sp|P32113|COPA_ENTHA | Probable copper-importing P-type ATPase A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copA PE=1 SV=2 | 583 | 802 | 4.0E-13 |
sp|P28876|PMA2_SCHPO | Plasma membrane ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma2 PE=3 SV=1 | 63 | 426 | 5.0E-13 |
sp|P58341|ATCU1_RHIME | Copper-transporting ATPase 1 OS=Rhizobium meliloti (strain 1021) GN=actP1 PE=3 SV=1 | 650 | 807 | 5.0E-13 |
sp|Q9XIE6|ALA3_ARATH | Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 | 323 | 698 | 6.0E-13 |
sp|P58342|ATCU2_RHIME | Copper-transporting ATPase 2 OS=Rhizobium meliloti (strain 1021) GN=actP2 PE=3 SV=1 | 650 | 807 | 6.0E-13 |
sp|P32660|ATC5_YEAST | Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 | 327 | 698 | 7.0E-13 |
sp|P57792|ALA12_ARATH | Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 | 370 | 746 | 7.0E-13 |
sp|Q8ZCA7|COPA_YERPE | Copper-exporting P-type ATPase A OS=Yersinia pestis GN=copA PE=3 SV=1 | 185 | 427 | 7.0E-13 |
sp|Q63FR0|KDPB_BACCZ | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ZK / E33L) GN=kdpB PE=3 SV=1 | 622 | 806 | 8.0E-13 |
sp|Q9LI83|ALA10_ARATH | Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 | 163 | 742 | 8.0E-13 |
sp|B7II09|KDPB_BACC2 | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain G9842) GN=kdpB PE=3 SV=1 | 622 | 806 | 9.0E-13 |
sp|B7JRB8|KDPB_BACC0 | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH820) GN=kdpB PE=3 SV=1 | 622 | 806 | 9.0E-13 |
sp|A9VFM1|KDPB_BACWK | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=kdpB PE=3 SV=1 | 622 | 806 | 1.0E-12 |
sp|A6QK47|COPA_STAAE | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Newman) GN=copA PE=3 SV=1 | 592 | 807 | 1.0E-12 |
sp|Q5HCZ3|COPA_STAAC | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain COL) GN=copA PE=3 SV=1 | 592 | 807 | 1.0E-12 |
sp|Q2FV64|COPA_STAA8 | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain NCTC 8325) GN=copA PE=1 SV=1 | 592 | 807 | 1.0E-12 |
sp|Q7A3E6|COPA_STAAN | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 | 592 | 807 | 1.0E-12 |
sp|Q99R80|COPA_STAAM | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 | 592 | 807 | 1.0E-12 |
sp|A5IVY3|COPA_STAA9 | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 | 592 | 807 | 1.0E-12 |
sp|A6U4T8|COPA_STAA2 | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 | 592 | 807 | 1.0E-12 |
sp|A7X6S1|COPA_STAA1 | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=copA PE=3 SV=1 | 592 | 807 | 1.0E-12 |
sp|A0RA13|KDPB_BACAH | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis (strain Al Hakam) GN=kdpB PE=3 SV=1 | 622 | 806 | 1.0E-12 |
sp|C3LF99|KDPB_BACAC | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=kdpB PE=3 SV=1 | 622 | 806 | 1.0E-12 |
sp|Q6HN78|KDPB_BACHK | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=kdpB PE=3 SV=1 | 622 | 806 | 1.0E-12 |
sp|A1A4J6|ATP9B_BOVIN | Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 | 370 | 786 | 1.0E-12 |
sp|Q64446|ATP7B_MOUSE | Copper-transporting ATPase 2 OS=Mus musculus GN=Atp7b PE=1 SV=2 | 651 | 802 | 1.0E-12 |
sp|C1EYK0|KDPB_BACC3 | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain 03BB102) GN=kdpB PE=3 SV=1 | 622 | 806 | 1.0E-12 |
sp|A8Z3F8|COPA_STAAT | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copA PE=3 SV=1 | 632 | 807 | 1.0E-12 |
sp|Q2FDV0|COPA_STAA3 | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300) GN=copA PE=3 SV=1 | 632 | 807 | 1.0E-12 |
sp|Q2YWA3|COPA_STAAB | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=copA PE=3 SV=1 | 592 | 807 | 2.0E-12 |
sp|P73867|KDPB_SYNY3 | Potassium-transporting ATPase ATP-binding subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=kdpB PE=3 SV=1 | 623 | 808 | 2.0E-12 |
sp|Q81HQ0|KDPB_BACCR | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=kdpB PE=3 SV=1 | 651 | 806 | 2.0E-12 |
sp|P57699|KDPB_HALSA | Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=kdpB PE=3 SV=1 | 645 | 808 | 2.0E-12 |
sp|B0R9M0|KDPB_HALS3 | Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=kdpB PE=2 SV=1 | 645 | 808 | 2.0E-12 |
sp|B7HDF9|KDPB_BACC4 | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain B4264) GN=kdpB PE=3 SV=1 | 622 | 806 | 2.0E-12 |
sp|B7HWG1|KDPB_BACC7 | Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH187) GN=kdpB PE=3 SV=1 | 651 | 806 | 2.0E-12 |
sp|Q9X5X3|ATCU_SINMW | Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=actP PE=1 SV=1 | 650 | 807 | 2.0E-12 |
sp|O32328|KDPB_CLOAB | Potassium-transporting ATPase ATP-binding subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=kdpB PE=3 SV=2 | 654 | 806 | 2.0E-12 |
sp|Q8NUQ9|COPA_STAAW | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MW2) GN=copA PE=3 SV=1 | 645 | 807 | 3.0E-12 |
sp|Q6G6B7|COPA_STAAS | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MSSA476) GN=copA PE=3 SV=1 | 645 | 807 | 3.0E-12 |
sp|Q9LVK9|ALA7_ARATH | Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 | 503 | 780 | 3.0E-12 |
sp|O30085|COPB_ARCFU | Copper-exporting P-type ATPase B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copB PE=1 SV=1 | 178 | 430 | 4.0E-12 |
sp|Q6GDP1|COPA_STAAR | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MRSA252) GN=copA PE=3 SV=1 | 592 | 807 | 4.0E-12 |
sp|Q64430|ATP7A_MOUSE | Copper-transporting ATPase 1 OS=Mus musculus GN=Atp7a PE=1 SV=3 | 651 | 806 | 5.0E-12 |
sp|F1Q4S1|ATP9B_DANRE | Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 | 363 | 782 | 5.0E-12 |
sp|P9WPS3|CTPV_MYCTU | Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpV PE=1 SV=1 | 644 | 802 | 5.0E-12 |
sp|P9WPS2|CTPV_MYCTO | Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpV PE=3 SV=1 | 644 | 802 | 5.0E-12 |
sp|Q926K7|KDPB2_LISIN | Potassium-transporting ATPase ATP-binding subunit 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB2 PE=3 SV=1 | 622 | 806 | 5.0E-12 |
sp|Q9LNQ4|ALA4_ARATH | Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 | 403 | 780 | 5.0E-12 |
sp|P98204|ALA1_ARATH | Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 | 352 | 780 | 7.0E-12 |
sp|Q04656|ATP7A_HUMAN | Copper-transporting ATPase 1 OS=Homo sapiens GN=ATP7A PE=1 SV=3 | 651 | 806 | 7.0E-12 |
sp|Q9X8Z9|KDPB_STRCO | Potassium-transporting ATPase ATP-binding subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=kdpB PE=3 SV=3 | 654 | 808 | 7.0E-12 |
sp|Q92XJ0|KDPB_RHIME | Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium meliloti (strain 1021) GN=kdpB PE=3 SV=1 | 591 | 806 | 9.0E-12 |
sp|P70705|ATP7A_RAT | Copper-transporting ATPase 1 OS=Rattus norvegicus GN=Atp7a PE=1 SV=1 | 651 | 806 | 9.0E-12 |
sp|Q9ZHC7|SILP_SALTM | Silver exporting P-type ATPase OS=Salmonella typhimurium GN=silP PE=1 SV=1 | 651 | 801 | 9.0E-12 |
sp|Q8K2X1|AT10D_MOUSE | Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 | 529 | 697 | 1.0E-11 |
sp|O70228|ATP9A_MOUSE | Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 | 198 | 782 | 1.0E-11 |
sp|P9WPT1|CTPE_MYCTU | Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpE PE=1 SV=1 | 649 | 813 | 1.0E-11 |
sp|P0A505|CTPE_MYCBO | Probable cation-transporting ATPase E OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpE PE=3 SV=1 | 649 | 813 | 1.0E-11 |
sp|P9WPT0|CTPE_MYCTO | Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpE PE=3 SV=1 | 649 | 813 | 1.0E-11 |
sp|Q9XT50|ATP7B_SHEEP | Copper-transporting ATPase 2 OS=Ovis aries GN=ATP7B PE=2 SV=1 | 627 | 806 | 1.0E-11 |
sp|Q64535|ATP7B_RAT | Copper-transporting ATPase 2 OS=Rattus norvegicus GN=Atp7b PE=1 SV=1 | 651 | 802 | 2.0E-11 |
sp|Q57RN0|KDPB_SALCH | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella choleraesuis (strain SC-B67) GN=kdpB PE=3 SV=1 | 623 | 806 | 2.0E-11 |
sp|O32220|COPA_BACSU | Copper-exporting P-type ATPase A OS=Bacillus subtilis (strain 168) GN=copA PE=1 SV=2 | 651 | 806 | 2.0E-11 |
sp|O31688|ZOSA_BACSU | Zinc-transporting ATPase OS=Bacillus subtilis (strain 168) GN=zosA PE=1 SV=1 | 654 | 809 | 2.0E-11 |
sp|Q8YSD5|KDPB2_NOSS1 | Potassium-transporting ATPase ATP-binding subunit 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB2 PE=3 SV=1 | 623 | 806 | 2.0E-11 |
sp|P35670|ATP7B_HUMAN | Copper-transporting ATPase 2 OS=Homo sapiens GN=ATP7B PE=1 SV=4 | 651 | 802 | 2.0E-11 |
sp|Q98GX6|KDPB_RHILO | Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium loti (strain MAFF303099) GN=kdpB PE=3 SV=1 | 588 | 808 | 2.0E-11 |
sp|P73241|ATCS_SYNY3 | Probable copper-transporting ATPase PacS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pacS PE=1 SV=1 | 116 | 428 | 3.0E-11 |
sp|P37279|ATCS_SYNE7 | Probable copper-transporting ATPase PacS OS=Synechococcus elongatus (strain PCC 7942) GN=pacS PE=3 SV=2 | 650 | 807 | 3.0E-11 |
sp|A3FIN4|AT8B5_MOUSE | Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 | 144 | 697 | 4.0E-11 |
sp|P38360|ATU1_YEAST | P-type cation-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCA1 PE=1 SV=2 | 163 | 434 | 4.0E-11 |
sp|P49015|ATP7A_CRIGR | Copper-transporting ATPase 1 (Fragment) OS=Cricetulus griseus GN=ATP7A PE=2 SV=1 | 651 | 806 | 4.0E-11 |
sp|P37279|ATCS_SYNE7 | Probable copper-transporting ATPase PacS OS=Synechococcus elongatus (strain PCC 7942) GN=pacS PE=3 SV=2 | 117 | 428 | 6.0E-11 |
sp|P23980|PMA2_SOLLC | Plasma membrane ATPase 2 (Fragment) OS=Solanum lycopersicum GN=LHA2 PE=3 SV=1 | 530 | 808 | 7.0E-11 |
sp|O75110|ATP9A_HUMAN | Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 | 198 | 782 | 8.0E-11 |
sp|Q4L970|COPA_STAHJ | Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 | 121 | 423 | 9.0E-11 |
sp|P20649|PMA1_ARATH | ATPase 1, plasma membrane-type OS=Arabidopsis thaliana GN=AHA1 PE=1 SV=3 | 591 | 808 | 1.0E-10 |
sp|P05425|COPB_ENTHA | Copper-exporting P-type ATPase B OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copB PE=1 SV=2 | 195 | 431 | 1.0E-10 |
sp|P05425|COPB_ENTHA | Copper-exporting P-type ATPase B OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copB PE=1 SV=2 | 647 | 809 | 1.0E-10 |
sp|Q8CN02|COPA_STAES | Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1 | 595 | 807 | 1.0E-10 |
sp|Q5HL56|COPA_STAEQ | Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1 | 595 | 807 | 1.0E-10 |
sp|Q9S7J8|HMA7_ARATH | Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 | 644 | 802 | 1.0E-10 |
sp|Q4L970|COPA_STAHJ | Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 | 651 | 802 | 2.0E-10 |
sp|Q9R6X1|KDPB_ANASL | Potassium-transporting ATPase ATP-binding subunit OS=Anabaena sp. (strain L31) GN=kdpB PE=3 SV=1 | 615 | 806 | 2.0E-10 |
sp|Q8XU11|KDPB_RALSO | Potassium-transporting ATPase ATP-binding subunit OS=Ralstonia solanacearum (strain GMI1000) GN=kdpB PE=3 SV=1 | 654 | 806 | 2.0E-10 |
sp|Q9SZW4|HMA2_ARATH | Cadmium/zinc-transporting ATPase HMA2 OS=Arabidopsis thaliana GN=HMA2 PE=2 SV=1 | 651 | 802 | 2.0E-10 |
sp|Q9SH30|HMA5_ARATH | Probable copper-transporting ATPase HMA5 OS=Arabidopsis thaliana GN=HMA5 PE=1 SV=2 | 648 | 802 | 2.0E-10 |
sp|Q93MV5|KDPB_MYXXA | Potassium-transporting ATPase ATP-binding subunit OS=Myxococcus xanthus GN=kdpB PE=3 SV=1 | 648 | 808 | 3.0E-10 |
sp|Q6GIX4|COPB_STAAR | Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain MRSA252) GN=copB PE=3 SV=1 | 570 | 800 | 3.0E-10 |
sp|P9WPS3|CTPV_MYCTU | Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpV PE=1 SV=1 | 194 | 436 | 4.0E-10 |
sp|P9WPS2|CTPV_MYCTO | Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpV PE=3 SV=1 | 194 | 436 | 4.0E-10 |
sp|Q8KU73|KDPB_ENTFA | Potassium-transporting ATPase ATP-binding subunit OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=kdpB PE=3 SV=1 | 654 | 808 | 4.0E-10 |
sp|Q4LAI2|KDPB_STAHJ | Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=kdpB PE=3 SV=1 | 642 | 808 | 4.0E-10 |
sp|Q5HK64|KDPB_STAEQ | Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=kdpB PE=3 SV=1 | 642 | 808 | 4.0E-10 |
sp|Q6GKN3|KDPB1_STAAR | Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB1 PE=3 SV=1 | 642 | 808 | 4.0E-10 |
sp|P0A008|KDPB1_STAAN | Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain N315) GN=kdpB1 PE=3 SV=1 | 642 | 808 | 4.0E-10 |
sp|P0A007|KDPB1_STAAM | Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB1 PE=3 SV=1 | 642 | 808 | 4.0E-10 |
sp|Q8YPE9|KDPB1_NOSS1 | Potassium-transporting ATPase ATP-binding subunit 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB1 PE=3 SV=1 | 615 | 806 | 4.0E-10 |
sp|P58341|ATCU1_RHIME | Copper-transporting ATPase 1 OS=Rhizobium meliloti (strain 1021) GN=actP1 PE=3 SV=1 | 195 | 423 | 5.0E-10 |
sp|Q9CCL1|CTPC_MYCLE | Probable cation-transporting P-type ATPase C OS=Mycobacterium leprae (strain TN) GN=ctpC PE=3 SV=1 | 633 | 809 | 5.0E-10 |
sp|A4SZG8|KDPB_POLSQ | Potassium-transporting ATPase ATP-binding subunit OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=kdpB PE=3 SV=1 | 654 | 806 | 5.0E-10 |
sp|Q69HU0|COPB_STAAU | Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus GN=copB PE=3 SV=1 | 570 | 800 | 5.0E-10 |
sp|O64474|HMA4_ARATH | Putative cadmium/zinc-transporting ATPase HMA4 OS=Arabidopsis thaliana GN=HMA4 PE=1 SV=2 | 651 | 806 | 6.0E-10 |
sp|P58342|ATCU2_RHIME | Copper-transporting ATPase 2 OS=Rhizobium meliloti (strain 1021) GN=actP2 PE=3 SV=1 | 197 | 423 | 8.0E-10 |
sp|Q8Z8E5|KDPB_SALTI | Putative potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhi GN=kdpB PE=5 SV=1 | 623 | 806 | 9.0E-10 |
sp|P37385|ATSY_SYNE7 | Probable copper-transporting ATPase SynA OS=Synechococcus elongatus (strain PCC 7942) GN=synA PE=3 SV=1 | 642 | 801 | 1.0E-09 |
sp|Q9SLK6|ALA6_ARATH | Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 | 491 | 697 | 1.0E-09 |
sp|P07893|ATSY_SYNP6 | Probable copper-transporting ATPase SynA OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=synA PE=3 SV=2 | 642 | 801 | 1.0E-09 |
sp|P77871|COPA1_HELPX | Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=2 | 652 | 802 | 1.0E-09 |
sp|P54211|PMA1_DUNBI | Plasma membrane ATPase OS=Dunaliella bioculata GN=PMA1 PE=2 SV=1 | 531 | 808 | 2.0E-09 |
sp|P9WPT1|CTPE_MYCTU | Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpE PE=1 SV=1 | 186 | 431 | 2.0E-09 |
sp|P0A505|CTPE_MYCBO | Probable cation-transporting ATPase E OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpE PE=3 SV=1 | 186 | 431 | 2.0E-09 |
sp|P9WPT0|CTPE_MYCTO | Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpE PE=3 SV=1 | 186 | 431 | 2.0E-09 |
sp|B4SZB1|KDPB_SALNS | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella newport (strain SL254) GN=kdpB PE=3 SV=1 | 623 | 806 | 2.0E-09 |
sp|C4LDL7|KDPB_TOLAT | Potassium-transporting ATPase ATP-binding subunit OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=kdpB PE=3 SV=1 | 650 | 806 | 2.0E-09 |
sp|Q9ZM69|COPA_HELPJ | Copper-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=copA PE=3 SV=1 | 652 | 807 | 2.0E-09 |
sp|A6T6D8|KDPB_KLEP7 | Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=kdpB PE=3 SV=1 | 649 | 806 | 2.0E-09 |
sp|B5FNE0|KDPB_SALDC | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella dublin (strain CT_02021853) GN=kdpB PE=3 SV=1 | 623 | 806 | 2.0E-09 |
sp|Q8ZQW2|KDPB_SALTY | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=kdpB PE=3 SV=1 | 623 | 806 | 2.0E-09 |
sp|B4TQ22|KDPB_SALSV | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella schwarzengrund (strain CVM19633) GN=kdpB PE=3 SV=1 | 623 | 806 | 2.0E-09 |
sp|A9MUE0|KDPB_SALPB | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=kdpB PE=3 SV=1 | 623 | 806 | 2.0E-09 |
sp|B4TBA6|KDPB_SALHS | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella heidelberg (strain SL476) GN=kdpB PE=3 SV=1 | 623 | 806 | 2.0E-09 |
sp|B5QWE9|KDPB_SALEP | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella enteritidis PT4 (strain P125109) GN=kdpB PE=3 SV=1 | 623 | 806 | 2.0E-09 |
sp|B5R670|KDPB_SALG2 | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=kdpB PE=3 SV=1 | 623 | 806 | 2.0E-09 |
sp|B5XZE9|KDPB_KLEP3 | Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae (strain 342) GN=kdpB PE=3 SV=1 | 649 | 806 | 2.0E-09 |
sp|B5BCA4|KDPB_SALPK | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain AKU_12601) GN=kdpB PE=3 SV=1 | 623 | 806 | 2.0E-09 |
sp|Q5PCJ7|KDPB_SALPA | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=kdpB PE=3 SV=1 | 623 | 806 | 2.0E-09 |
sp|Q0TRT3|KDPB_CLOP1 | Potassium-transporting ATPase ATP-binding subunit OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=kdpB PE=3 SV=1 | 622 | 806 | 3.0E-09 |
sp|B7M5L3|KDPB_ECO8A | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O8 (strain IAI1) GN=kdpB PE=3 SV=1 | 651 | 806 | 3.0E-09 |
sp|B7LAA4|KDPB_ECO55 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain 55989 / EAEC) GN=kdpB PE=3 SV=1 | 651 | 806 | 3.0E-09 |
sp|Q4A0G1|COPA_STAS1 | Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1 | 651 | 807 | 3.0E-09 |
sp|B7LKR7|KDPB_ESCF3 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=kdpB PE=3 SV=1 | 651 | 806 | 3.0E-09 |
sp|A1JQS2|KDPB_YERE8 | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=kdpB PE=3 SV=1 | 654 | 806 | 3.0E-09 |
sp|B1JR96|KDPB_YERPY | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=kdpB PE=3 SV=1 | 654 | 806 | 3.0E-09 |
sp|A7FFQ9|KDPB_YERP3 | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=kdpB PE=3 SV=1 | 654 | 806 | 3.0E-09 |
sp|B7MPK0|KDPB_ECO81 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O81 (strain ED1a) GN=kdpB PE=3 SV=1 | 651 | 806 | 3.0E-09 |
sp|Q667S4|KDPB_YERPS | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=kdpB PE=3 SV=1 | 654 | 806 | 3.0E-09 |
sp|Q3Z4A6|KDPB_SHISS | Potassium-transporting ATPase ATP-binding subunit OS=Shigella sonnei (strain Ss046) GN=kdpB PE=3 SV=1 | 651 | 806 | 3.0E-09 |
sp|Q1REM0|KDPB_ECOUT | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain UTI89 / UPEC) GN=kdpB PE=3 SV=1 | 651 | 806 | 3.0E-09 |
sp|A1A8W1|KDPB_ECOK1 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O1:K1 / APEC GN=kdpB PE=3 SV=1 | 651 | 806 | 3.0E-09 |
sp|B7MFW2|KDPB_ECO45 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=kdpB PE=3 SV=1 | 651 | 806 | 3.0E-09 |
sp|Q8FJV4|KDPB_ECOL6 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=kdpB PE=3 SV=1 | 651 | 806 | 4.0E-09 |
sp|Q0TJY9|KDPB_ECOL5 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=kdpB PE=3 SV=1 | 651 | 806 | 4.0E-09 |
sp|B7UKX6|KDPB_ECO27 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=kdpB PE=3 SV=1 | 651 | 806 | 4.0E-09 |
sp|B5EZE3|KDPB_SALA4 | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella agona (strain SL483) GN=kdpB PE=3 SV=1 | 623 | 806 | 4.0E-09 |
sp|P03960|KDPB_ECOLI | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12) GN=kdpB PE=1 SV=3 | 651 | 806 | 4.0E-09 |
sp|B1X6M8|KDPB_ECODH | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / DH10B) GN=kdpB PE=3 SV=1 | 651 | 806 | 4.0E-09 |
sp|C4ZWH3|KDPB_ECOBW | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=kdpB PE=3 SV=1 | 651 | 806 | 4.0E-09 |
sp|B1LLE1|KDPB_ECOSM | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=kdpB PE=3 SV=1 | 651 | 806 | 4.0E-09 |
sp|A4TL06|KDPB_YERPP | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis (strain Pestoides F) GN=kdpB PE=3 SV=1 | 654 | 806 | 4.0E-09 |
sp|Q1CKH2|KDPB_YERPN | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=kdpB PE=3 SV=1 | 654 | 806 | 4.0E-09 |
sp|A9R3X3|KDPB_YERPG | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Angola) GN=kdpB PE=3 SV=1 | 654 | 806 | 4.0E-09 |
sp|Q8ZD97|KDPB_YERPE | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis GN=kdpB PE=3 SV=1 | 654 | 806 | 4.0E-09 |
sp|B2KA78|KDPB_YERPB | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=kdpB PE=3 SV=1 | 654 | 806 | 4.0E-09 |
sp|Q1C586|KDPB_YERPA | Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=kdpB PE=3 SV=1 | 654 | 806 | 4.0E-09 |
sp|B7NMQ0|KDPB_ECO7I | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=kdpB PE=3 SV=1 | 651 | 806 | 4.0E-09 |
sp|B6HYQ5|KDPB_ECOSE | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SE11) GN=kdpB PE=3 SV=1 | 651 | 806 | 4.0E-09 |
sp|B7N9U0|KDPB_ECOLU | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=kdpB PE=3 SV=1 | 651 | 806 | 4.0E-09 |
sp|A7ZJ80|KDPB_ECO24 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=kdpB PE=3 SV=1 | 651 | 806 | 4.0E-09 |
sp|A7ZXV8|KDPB_ECOHS | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O9:H4 (strain HS) GN=kdpB PE=3 SV=1 | 651 | 806 | 4.0E-09 |
sp|B5YQN9|KDPB_ECO5E | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=kdpB PE=3 SV=1 | 651 | 806 | 4.0E-09 |
sp|Q8X9F9|KDPB_ECO57 | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 GN=kdpB PE=3 SV=1 | 651 | 806 | 4.0E-09 |
sp|Q8XD24|COPA_ECO57 | Copper-exporting P-type ATPase A OS=Escherichia coli O157:H7 GN=copA PE=3 SV=3 | 642 | 807 | 4.0E-09 |
sp|Q59385|COPA_ECOLI | Copper-exporting P-type ATPase A OS=Escherichia coli (strain K12) GN=copA PE=1 SV=4 | 642 | 807 | 4.0E-09 |
sp|A8Z4X9|KDPB_STAAT | Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=kdpB PE=3 SV=1 | 654 | 806 | 4.0E-09 |
sp|A6QIS1|KDPB_STAAE | Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain Newman) GN=kdpB PE=3 SV=1 | 654 | 806 | 4.0E-09 |
sp|Q5HEC4|KDPB_STAAC | Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain COL) GN=kdpB PE=3 SV=1 | 654 | 806 | 4.0E-09 |
sp|Q6GEZ7|KDPB2_STAAR | Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB2 PE=3 SV=1 | 654 | 806 | 4.0E-09 |
sp|P63684|KDPB2_STAAN | Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain N315) GN=kdpB2 PE=3 SV=1 | 654 | 806 | 4.0E-09 |
sp|P63683|KDPB2_STAAM | Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB2 PE=3 SV=1 | 654 | 806 | 4.0E-09 |
sp|B1IY32|KDPB_ECOLC | Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=kdpB PE=3 SV=1 | 651 | 806 | 4.0E-09 |
sp|Q7N6W6|KDPB_PHOLL | Potassium-transporting ATPase ATP-binding subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=kdpB PE=3 SV=1 | 654 | 806 | 4.0E-09 |
sp|Q8NVI2|KDPB_STAAW | Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MW2) GN=kdpB PE=3 SV=1 | 654 | 806 | 4.0E-09 |
sp|Q6G7N3|KDPB_STAAS | Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MSSA476) GN=kdpB PE=3 SV=1 | 654 | 806 | 4.0E-09 |
sp|Q2YUH7|KDPB_STAAB | Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=kdpB PE=3 SV=1 | 654 | 806 | 5.0E-09 |
sp|Q59467|COPA2_HELPX | Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 | 652 | 807 | 5.0E-09 |
sp|Q324L0|KDPB_SHIBS | Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=kdpB PE=3 SV=1 | 651 | 806 | 5.0E-09 |
sp|Q8CQF7|COPB_STAES | Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copB PE=3 SV=1 | 172 | 484 | 5.0E-09 |
sp|Q4LAB1|COPB_STAHJ | Probable copper-transporting P-type ATPase B OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copB PE=3 SV=2 | 172 | 484 | 5.0E-09 |
sp|A4W860|KDPB_ENT38 | Potassium-transporting ATPase ATP-binding subunit OS=Enterobacter sp. (strain 638) GN=kdpB PE=3 SV=1 | 647 | 806 | 6.0E-09 |
sp|Q8ZR95|COPA_SALTY | Copper-exporting P-type ATPase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=copA PE=1 SV=3 | 650 | 807 | 7.0E-09 |
sp|Q8Z8S4|COPA_SALTI | Copper-exporting P-type ATPase A OS=Salmonella typhi GN=copA PE=3 SV=3 | 650 | 807 | 7.0E-09 |
sp|O29777|COPA_ARCFU | Probable copper-exporting P-type ATPase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copA PE=1 SV=1 | 186 | 428 | 7.0E-09 |
sp|Q6GIX1|CADA_STAAR | Probable cadmium-transporting ATPase OS=Staphylococcus aureus (strain MRSA252) GN=cadA PE=3 SV=1 | 645 | 806 | 8.0E-09 |
sp|Q8U9D9|KDPB_AGRFC | Potassium-transporting ATPase ATP-binding subunit OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=kdpB PE=3 SV=2 | 641 | 806 | 9.0E-09 |
sp|Q9LV11|PMA11_ARATH | ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=AHA11 PE=1 SV=1 | 524 | 808 | 1.0E-08 |
sp|P12522|ATXB_LEIDO | Probable proton ATPase 1B OS=Leishmania donovani GN=H1B PE=2 SV=1 | 596 | 808 | 1.0E-08 |
sp|P11718|ATXA_LEIDO | Probable proton ATPase 1A OS=Leishmania donovani GN=H1A PE=2 SV=2 | 596 | 808 | 1.0E-08 |
sp|Q9ZHC7|SILP_SALTM | Silver exporting P-type ATPase OS=Salmonella typhimurium GN=silP PE=1 SV=1 | 203 | 426 | 1.0E-08 |
sp|Q69HU0|COPB_STAAU | Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus GN=copB PE=3 SV=1 | 172 | 426 | 1.0E-08 |
sp|Q4A0G1|COPA_STAS1 | Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1 | 182 | 428 | 1.0E-08 |
sp|Q8CQF7|COPB_STAES | Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copB PE=3 SV=1 | 642 | 809 | 1.0E-08 |
sp|Q8ZR95|COPA_SALTY | Copper-exporting P-type ATPase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=copA PE=1 SV=3 | 185 | 427 | 1.0E-08 |
sp|Q8Z8S4|COPA_SALTI | Copper-exporting P-type ATPase A OS=Salmonella typhi GN=copA PE=3 SV=3 | 185 | 427 | 1.0E-08 |
sp|O08462|COPA3_HELPX | Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 | 651 | 807 | 1.0E-08 |
sp|P20021|CADA1_STAAU | Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 | 577 | 806 | 1.0E-08 |
sp|A8GB61|KDPB_SERP5 | Potassium-transporting ATPase ATP-binding subunit OS=Serratia proteamaculans (strain 568) GN=kdpB PE=3 SV=1 | 654 | 806 | 1.0E-08 |
sp|P55989|COPA_HELPY | Copper-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=copA PE=3 SV=1 | 652 | 807 | 1.0E-08 |
sp|Q5HKB0|COPB_STAEQ | Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copB PE=3 SV=2 | 642 | 809 | 1.0E-08 |
sp|Q9SGG3|ALA5_ARATH | Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 | 491 | 697 | 1.0E-08 |
sp|Q6GIX4|COPB_STAAR | Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain MRSA252) GN=copB PE=3 SV=1 | 172 | 426 | 2.0E-08 |
sp|Q5HKB0|COPB_STAEQ | Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copB PE=3 SV=2 | 172 | 484 | 2.0E-08 |
sp|P38995|ATU2_YEAST | Copper-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCC2 PE=1 SV=1 | 195 | 426 | 2.0E-08 |
sp|A8YZ02|COPB_STAAT | Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copB PE=3 SV=1 | 642 | 809 | 2.0E-08 |
sp|A8YZ02|COPB_STAAT | Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copB PE=3 SV=1 | 172 | 484 | 2.0E-08 |
sp|Q2FKI2|COPB_STAA3 | Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300) GN=copB PE=3 SV=1 | 642 | 809 | 2.0E-08 |
sp|Q2FKI2|COPB_STAA3 | Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300) GN=copB PE=3 SV=1 | 172 | 484 | 2.0E-08 |
sp|P9WPT5|CTPC_MYCTU | Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpC PE=1 SV=1 | 645 | 799 | 2.0E-08 |
sp|P9WPT4|CTPC_MYCTO | Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpC PE=3 SV=1 | 645 | 799 | 2.0E-08 |
sp|P0A503|CTPC_MYCBO | Probable cation-transporting P-type ATPase C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpC PE=3 SV=1 | 645 | 799 | 2.0E-08 |
sp|Q47H39|KDPB_DECAR | Potassium-transporting ATPase ATP-binding subunit OS=Dechloromonas aromatica (strain RCB) GN=kdpB PE=3 SV=1 | 654 | 806 | 2.0E-08 |
sp|B2VJK3|KDPB_ERWT9 | Potassium-transporting ATPase ATP-binding subunit OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=kdpB PE=3 SV=1 | 654 | 806 | 2.0E-08 |
sp|Q2YWA3|COPA_STAAB | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=copA PE=3 SV=1 | 114 | 428 | 3.0E-08 |
sp|Q8YSD5|KDPB2_NOSS1 | Potassium-transporting ATPase ATP-binding subunit 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB2 PE=3 SV=1 | 96 | 424 | 3.0E-08 |
sp|P37386|CADA2_STAAU | Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 | 645 | 806 | 3.0E-08 |
sp|P9WPT8|CTPB_MYCTO | Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpB PE=3 SV=1 | 194 | 431 | 3.0E-08 |
sp|P59947|CTPB_MYCBO | Cation-transporting P-type ATPase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpB PE=3 SV=1 | 194 | 431 | 3.0E-08 |
sp|P9WPT9|CTPB_MYCTU | Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpB PE=1 SV=1 | 194 | 431 | 3.0E-08 |
sp|A6QK47|COPA_STAAE | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Newman) GN=copA PE=3 SV=1 | 182 | 428 | 4.0E-08 |
sp|Q5HCZ3|COPA_STAAC | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain COL) GN=copA PE=3 SV=1 | 182 | 428 | 4.0E-08 |
sp|Q2FV64|COPA_STAA8 | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain NCTC 8325) GN=copA PE=1 SV=1 | 182 | 428 | 4.0E-08 |
sp|Q9X5X3|ATCU_SINMW | Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=actP PE=1 SV=1 | 197 | 423 | 4.0E-08 |
sp|Q8NUQ9|COPA_STAAW | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MW2) GN=copA PE=3 SV=1 | 182 | 428 | 4.0E-08 |
sp|Q6G6B7|COPA_STAAS | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MSSA476) GN=copA PE=3 SV=1 | 182 | 428 | 4.0E-08 |
sp|O32220|COPA_BACSU | Copper-exporting P-type ATPase A OS=Bacillus subtilis (strain 168) GN=copA PE=1 SV=2 | 172 | 423 | 4.0E-08 |
sp|Q4LAB1|COPB_STAHJ | Probable copper-transporting P-type ATPase B OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copB PE=3 SV=2 | 642 | 809 | 4.0E-08 |
sp|B2TMJ2|KDPB_CLOBB | Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=kdpB PE=3 SV=1 | 622 | 806 | 4.0E-08 |
sp|Q95050|ATX9_TETTH | Probable cation-transporting ATPase 9 OS=Tetrahymena thermophila GN=TPA9 PE=2 SV=1 | 97 | 698 | 4.0E-08 |
sp|A8Z3F8|COPA_STAAT | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copA PE=3 SV=1 | 182 | 428 | 5.0E-08 |
sp|Q2FDV0|COPA_STAA3 | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300) GN=copA PE=3 SV=1 | 182 | 428 | 5.0E-08 |
sp|Q8CN02|COPA_STAES | Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1 | 114 | 432 | 5.0E-08 |
sp|Q5HL56|COPA_STAEQ | Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1 | 114 | 432 | 5.0E-08 |
sp|Q8XD24|COPA_ECO57 | Copper-exporting P-type ATPase A OS=Escherichia coli O157:H7 GN=copA PE=3 SV=3 | 185 | 435 | 5.0E-08 |
sp|Q59385|COPA_ECOLI | Copper-exporting P-type ATPase A OS=Escherichia coli (strain K12) GN=copA PE=1 SV=4 | 185 | 435 | 5.0E-08 |
sp|P0CW78|HMA3B_ARATH | Cadmium/zinc-transporting ATPase HMA3 OS=Arabidopsis thaliana GN=HMA3 PE=1 SV=1 | 652 | 798 | 5.0E-08 |
sp|Q8PPC9|KDPB_XANAC | Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas axonopodis pv. citri (strain 306) GN=kdpB PE=3 SV=1 | 560 | 806 | 5.0E-08 |
sp|P57698|KDPB_PSEAE | Potassium-transporting ATPase ATP-binding subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=kdpB PE=3 SV=1 | 560 | 808 | 5.0E-08 |
sp|Q8PCM1|KDPB_XANCP | Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=kdpB PE=3 SV=1 | 591 | 806 | 5.0E-08 |
sp|B2V2P3|KDPB_CLOBA | Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=kdpB PE=3 SV=1 | 622 | 806 | 5.0E-08 |
sp|P32113|COPA_ENTHA | Probable copper-importing P-type ATPase A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copA PE=1 SV=2 | 185 | 423 | 6.0E-08 |
sp|Q7A3E6|COPA_STAAN | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 | 182 | 428 | 7.0E-08 |
sp|Q99R80|COPA_STAAM | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 | 182 | 428 | 7.0E-08 |
sp|A5IVY3|COPA_STAA9 | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 | 182 | 428 | 7.0E-08 |
sp|A6U4T8|COPA_STAA2 | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 | 182 | 428 | 7.0E-08 |
sp|A7X6S1|COPA_STAA1 | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=copA PE=3 SV=1 | 182 | 428 | 7.0E-08 |
sp|Q9R6X1|KDPB_ANASL | Potassium-transporting ATPase ATP-binding subunit OS=Anabaena sp. (strain L31) GN=kdpB PE=3 SV=1 | 99 | 424 | 7.0E-08 |
sp|O29777|COPA_ARCFU | Probable copper-exporting P-type ATPase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copA PE=1 SV=1 | 651 | 806 | 7.0E-08 |
sp|Q71W90|KDPB_LISMF | Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=kdpB PE=3 SV=1 | 654 | 806 | 7.0E-08 |
sp|C1KZN5|KDPB_LISMC | Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=kdpB PE=3 SV=1 | 654 | 806 | 7.0E-08 |
sp|O36028|ATCZ_SCHPO | Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 | 360 | 720 | 7.0E-08 |
sp|Q927G0|KDPB1_LISIN | Potassium-transporting ATPase ATP-binding subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB1 PE=3 SV=1 | 654 | 806 | 7.0E-08 |
sp|B8DAW1|KDPB_LISMH | Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=kdpB PE=3 SV=1 | 654 | 806 | 8.0E-08 |
sp|A0AM16|KDPB_LISW6 | Potassium-transporting ATPase ATP-binding subunit OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=kdpB PE=3 SV=1 | 654 | 806 | 8.0E-08 |
sp|Q8Y3Z7|KDPB_LISMO | Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=kdpB PE=3 SV=1 | 654 | 806 | 8.0E-08 |
sp|Q9HD20|AT131_HUMAN | Manganese-transporting ATPase 13A1 OS=Homo sapiens GN=ATP13A1 PE=1 SV=2 | 169 | 426 | 9.0E-08 |
sp|Q8R8I6|KDPB_CALS4 | Potassium-transporting ATPase ATP-binding subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=kdpB PE=3 SV=1 | 96 | 424 | 1.0E-07 |
sp|P35597|EXP7_STRPN | Probable cation-transporting ATPase exp7 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp7 PE=3 SV=2 | 181 | 426 | 1.0E-07 |
sp|Q6GDP1|COPA_STAAR | Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MRSA252) GN=copA PE=3 SV=1 | 114 | 442 | 1.0E-07 |
sp|Q9S7J8|HMA7_ARATH | Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 | 203 | 435 | 1.0E-07 |
sp|B2TTJ7|KDPB_SHIB3 | Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=kdpB PE=3 SV=1 | 651 | 806 | 1.0E-07 |
sp|Q9EPE9|AT131_MOUSE | Manganese-transporting ATPase 13A1 OS=Mus musculus GN=Atp13a1 PE=1 SV=2 | 169 | 426 | 1.0E-07 |
sp|P30336|CADA_BACPE | Probable cadmium-transporting ATPase OS=Bacillus pseudofirmus (strain OF4) GN=cadA PE=3 SV=2 | 584 | 795 | 1.0E-07 |
sp|O32619|COPA_HELFC | Copper-transporting ATPase OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=copA PE=3 SV=1 | 119 | 420 | 2.0E-07 |
sp|P9WPU1|CTPA_MYCTU | Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpA PE=1 SV=1 | 651 | 807 | 2.0E-07 |
sp|P9WPU0|CTPA_MYCTO | Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpA PE=3 SV=1 | 651 | 807 | 2.0E-07 |
sp|B9DFX7|HMA8_ARATH | Copper-transporting ATPase PAA2, chloroplastic OS=Arabidopsis thaliana GN=PAA2 PE=2 SV=1 | 195 | 426 | 2.0E-07 |
sp|Q9KPZ7|COPA_VIBCH | Copper-exporting P-type ATPase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=copA PE=3 SV=1 | 195 | 420 | 3.0E-07 |
sp|O59666|ATU2_SCHPO | Copper-transporting ATPase ccc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccc2 PE=3 SV=1 | 203 | 436 | 3.0E-07 |
sp|Q9HD20|AT131_HUMAN | Manganese-transporting ATPase 13A1 OS=Homo sapiens GN=ATP13A1 PE=1 SV=2 | 704 | 777 | 4.0E-07 |
sp|O59666|ATU2_SCHPO | Copper-transporting ATPase ccc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccc2 PE=3 SV=1 | 645 | 790 | 4.0E-07 |
sp|P77868|Y290_HAEIN | Probable cation-transporting ATPase HI_0290 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0290 PE=3 SV=1 | 652 | 807 | 4.0E-07 |
sp|P09627|PMA1_SCHPO | Plasma membrane ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma1 PE=1 SV=1 | 673 | 808 | 5.0E-07 |
sp|Q9EPE9|AT131_MOUSE | Manganese-transporting ATPase 13A1 OS=Mus musculus GN=Atp13a1 PE=1 SV=2 | 704 | 777 | 5.0E-07 |
sp|Q9UT43|YFRD_SCHPO | Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 | 355 | 594 | 5.0E-07 |
sp|O60312|AT10A_HUMAN | Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 | 529 | 699 | 5.0E-07 |
sp|Q60048|CADA_LISMN | Probable cadmium-transporting ATPase OS=Listeria monocytogenes GN=cadA PE=1 SV=1 | 647 | 798 | 6.0E-07 |
sp|O30085|COPB_ARCFU | Copper-exporting P-type ATPase B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copB PE=1 SV=1 | 656 | 809 | 8.0E-07 |
sp|O14022|CTA5_SCHPO | Cation-transporting ATPase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta5 PE=3 SV=1 | 141 | 422 | 8.0E-07 |
sp|Q9SZC9|HMA6_ARATH | Copper-transporting ATPase PAA1, chloroplastic OS=Arabidopsis thaliana GN=PAA1 PE=2 SV=1 | 195 | 431 | 8.0E-07 |
sp|Q8YPE9|KDPB1_NOSS1 | Potassium-transporting ATPase ATP-binding subunit 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB1 PE=3 SV=1 | 65 | 424 | 1.0E-06 |
sp|P58414|CADA_LISMO | Probable cadmium-transporting ATPase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cadA PE=3 SV=1 | 647 | 798 | 1.0E-06 |
sp|P46840|CTPB_MYCLE | Cation-transporting P-type ATPase B OS=Mycobacterium leprae (strain TN) GN=ctpB PE=3 SV=2 | 195 | 430 | 1.0E-06 |
sp|P59219|KDPB_LEPIN | Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=kdpB PE=3 SV=2 | 654 | 808 | 1.0E-06 |
sp|Q72TM6|KDPB_LEPIC | Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=kdpB PE=3 SV=1 | 654 | 808 | 1.0E-06 |
sp|Q09891|ATCX_SCHPO | Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 | 494 | 729 | 1.0E-06 |
sp|O32328|KDPB_CLOAB | Potassium-transporting ATPase ATP-binding subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=kdpB PE=3 SV=2 | 108 | 436 | 2.0E-06 |
sp|Q98GX6|KDPB_RHILO | Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium loti (strain MAFF303099) GN=kdpB PE=3 SV=1 | 192 | 420 | 2.0E-06 |
sp|A4W860|KDPB_ENT38 | Potassium-transporting ATPase ATP-binding subunit OS=Enterobacter sp. (strain 638) GN=kdpB PE=3 SV=1 | 107 | 420 | 2.0E-06 |
sp|O32219|CADA_BACSU | Cadmium, zinc and cobalt-transporting ATPase OS=Bacillus subtilis (strain 168) GN=cadA PE=1 SV=1 | 638 | 802 | 2.0E-06 |
sp|Q9XT50|ATP7B_SHEEP | Copper-transporting ATPase 2 OS=Ovis aries GN=ATP7B PE=2 SV=1 | 195 | 421 | 3.0E-06 |
sp|P77868|Y290_HAEIN | Probable cation-transporting ATPase HI_0290 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0290 PE=3 SV=1 | 182 | 426 | 3.0E-06 |
sp|P58414|CADA_LISMO | Probable cadmium-transporting ATPase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cadA PE=3 SV=1 | 143 | 428 | 3.0E-06 |
sp|P38995|ATU2_YEAST | Copper-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCC2 PE=1 SV=1 | 651 | 802 | 4.0E-06 |
sp|Q47H39|KDPB_DECAR | Potassium-transporting ATPase ATP-binding subunit OS=Dechloromonas aromatica (strain RCB) GN=kdpB PE=3 SV=1 | 190 | 454 | 4.0E-06 |
sp|Q9X8Z9|KDPB_STRCO | Potassium-transporting ATPase ATP-binding subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=kdpB PE=3 SV=3 | 131 | 420 | 5.0E-06 |
sp|P9WPT8|CTPB_MYCTO | Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpB PE=3 SV=1 | 734 | 807 | 6.0E-06 |
sp|P59947|CTPB_MYCBO | Cation-transporting P-type ATPase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpB PE=3 SV=1 | 734 | 807 | 6.0E-06 |
sp|P9WPT9|CTPB_MYCTU | Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpB PE=1 SV=1 | 734 | 807 | 7.0E-06 |
sp|B5FNE0|KDPB_SALDC | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella dublin (strain CT_02021853) GN=kdpB PE=3 SV=1 | 195 | 420 | 8.0E-06 |
sp|B5R670|KDPB_SALG2 | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=kdpB PE=3 SV=1 | 195 | 420 | 8.0E-06 |
sp|B4SZB1|KDPB_SALNS | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella newport (strain SL254) GN=kdpB PE=3 SV=1 | 195 | 420 | 9.0E-06 |
sp|Q8ZQW2|KDPB_SALTY | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=kdpB PE=3 SV=1 | 195 | 420 | 9.0E-06 |
sp|B4TQ22|KDPB_SALSV | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella schwarzengrund (strain CVM19633) GN=kdpB PE=3 SV=1 | 195 | 420 | 9.0E-06 |
sp|A9MUE0|KDPB_SALPB | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=kdpB PE=3 SV=1 | 195 | 420 | 9.0E-06 |
sp|B4TBA6|KDPB_SALHS | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella heidelberg (strain SL476) GN=kdpB PE=3 SV=1 | 195 | 420 | 9.0E-06 |
sp|B5QWE9|KDPB_SALEP | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella enteritidis PT4 (strain P125109) GN=kdpB PE=3 SV=1 | 195 | 420 | 9.0E-06 |
sp|B5EZE3|KDPB_SALA4 | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella agona (strain SL483) GN=kdpB PE=3 SV=1 | 195 | 420 | 9.0E-06 |
sp|Q57RN0|KDPB_SALCH | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella choleraesuis (strain SC-B67) GN=kdpB PE=3 SV=1 | 195 | 420 | 1.0E-05 |
sp|B5BCA4|KDPB_SALPK | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain AKU_12601) GN=kdpB PE=3 SV=1 | 195 | 420 | 1.0E-05 |
sp|Q5PCJ7|KDPB_SALPA | Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=kdpB PE=3 SV=1 | 195 | 420 | 1.0E-05 |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 12 | 0.45 |
Domain # | Start | End | Length |
---|---|---|---|
1 | 110 | 132 | 22 |
2 | 142 | 164 | 22 |
3 | 276 | 298 | 22 |
4 | 313 | 335 | 22 |
5 | 356 | 378 | 22 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|1603 MARRTPALLSPEELSALHGPGPDIDNLAALGRLGGLGGLESGLRTSLESGLDACETSLDRGVPGKAEAARPRPPD AALFAERRRRFLDNQLPTKRQPTFVQLLWRSYNDPALFLLTAAAVASLAVDLYQTLGTAHSAANPPVEWVQGVAI LVAILVIVLVSSVNDWGKQRQFRKLSRRQLQRDIKVVRSAALRLIPISELVVGDVAQLEPGDVVPADGVLISGQN LSCDEAAVTGESDLVLKTPGHAALAALSSSEPPRRSLLDPFLRSGTRVLDGVGTFLVTATGINSTYGQVLASVRD EPEPTPLQVRLTAVTKVIAHAGGFFALFLFVVLFVKFLARLPYDAGTPVAKGRDFVSIVIIAVTVLVIAVPEGLP LAVTLSLAIASIRMMKDNNLVRQLKACETMGNATDVCSDKTGTLTQNRMTVVNCTVGADMQFHDPALAPNLPDSR SATVQGTGNSPARLEQVALKLAPDVKFMLRQSISLNSMAFEARDAPAFVGSSTESALLHFARRHLAMGPVGSERS AAGVIQLIPFNAARQCMATVVRLPGSNTRCRVLVKGASEILLSRCSTVIRDPKRGCQVTEMTSQARQGLSDTIDS YAGHALRTITLAFRDLDLDHTEYVTSRGGADDTQTHWNLDSLVHDLSFICLFGIHDAIRPGVPQAVEACGEAGIT VRMVTGDNVQTARAVATHCGILSYSRGDLSMEGLEFRAMSDVQAMEMLPRLKVLARSSPQDKQRLVALLKEMGRT VAVTGDGTNDVAALSTADVSFAMGGNSGTEVAREASSIILTNDDFTSIIRAILWGRAINDSER* |
Coding | >Hirsu2|1603 ATGGCTCGTAGGACACCCGCCTTGCTTTCTCCCGAGGAGCTGAGCGCCCTTCACGGCCCCGGCCCCGACATCGAC AACCTAGCGGCGCTAGGCCGGCTCGGAGGCCTCGGCGGCCTCGAGAGCGGGCTGCGAACCAGCCTCGAGAGCGGC CTGGATGCCTGCGAAACCAGCCTCGACCGTGGCGTCCCGGGCAAGGCTGAAGCAGCCCGTCCGCGGCCGCCCGAC GCCGCGCTCTTCGCCGAACGCAGGCGCCGCTTTCTCGATAACCAACTGCCGACTAAGAGGCAGCCGACCTTTGTC CAGCTGCTCTGGCGCTCCTACAACGACCCGGCCCTCTTTCTGCTGACGGCCGCCGCTGTCGCCTCGCTCGCCGTC GACCTATACCAGACACTGGGCACCGCTCACTCAGCCGCCAATCCGCCCGTCGAATGGGTGCAGGGAGTCGCCATC CTCGTCGCCATCCTCGTTATTGTCCTCGTCAGCTCCGTCAACGACTGGGGCAAGCAGCGCCAGTTCCGGAAACTC AGCCGGCGTCAGCTGCAGCGCGACATCAAAGTCGTTCGCTCTGCTGCCCTGCGCCTTATCCCCATCTCTGAGCTG GTCGTCGGCGATGTCGCTCAGCTCGAGCCCGGCGACGTCGTACCAGCCGATGGCGTCCTCATTTCTGGCCAGAAC CTCTCATGCGACGAGGCGGCGGTAACCGGTGAGAGTGACTTGGTCCTGAAGACGCCTGGCCACGCCGCTCTCGCC GCCCTCTCGAGCAGCGAGCCGCCGCGCCGCAGCCTCCTCGATCCCTTTCTTCGCTCGGGCACACGGGTGCTCGAT GGCGTCGGCACGTTTCTTGTCACCGCCACAGGCATCAACTCCACCTATGGCCAGGTCCTGGCCTCGGTCAGAGAT GAGCCCGAGCCCACGCCTCTGCAGGTCCGCCTCACGGCCGTCACCAAGGTCATCGCCCACGCCGGCGGCTTCTTT GCCCTCTTTCTCTTTGTTGTCCTCTTCGTCAAGTTCCTCGCCAGGCTCCCGTACGATGCAGGAACACCGGTCGCC AAAGGCAGAGACTTTGTCAGCATTGTCATCATTGCCGTGACCGTGCTGGTCATAGCCGTCCCCGAAGGCCTCCCC CTCGCCGTCACGCTGTCCCTGGCCATCGCTTCGATAAGAATGATGAAGGACAACAACCTGGTTCGGCAACTGAAG GCCTGCGAGACCATGGGAAACGCCACGGATGTCTGCTCCGACAAGACTGGAACGCTGACCCAGAATCGTATGACC GTCGTCAACTGCACTGTTGGCGCCGATATGCAGTTTCACGATCCGGCCCTGGCTCCCAACCTACCCGACTCGCGT TCGGCCACAGTGCAGGGGACTGGAAATTCTCCTGCCCGCCTTGAACAGGTTGCTCTCAAGCTTGCTCCCGATGTC AAGTTCATGCTCCGCCAATCGATTTCCCTTAACTCGATGGCTTTTGAGGCGAGAGACGCCCCGGCCTTCGTCGGG TCCAGCACCGAGTCCGCTCTTCTGCACTTTGCCAGACGTCATCTGGCCATGGGGCCGGTAGGGTCGGAGCGGTCT GCAGCAGGCGTCATACAACTCATCCCTTTCAATGCCGCGCGGCAGTGCATGGCAACCGTCGTCAGACTGCCCGGC AGCAATACCCGATGTAGGGTCTTGGTCAAGGGCGCTTCCGAGATCTTACTGTCGAGATGTTCCACAGTCATCCGC GATCCCAAACGGGGCTGCCAAGTTACGGAGATGACGAGCCAGGCGCGGCAAGGGCTATCTGACACCATCGACAGT TACGCCGGCCACGCCCTTCGGACAATCACTCTAGCATTCCGCGACTTAGATCTCGACCACACTGAGTACGTAACG TCCAGAGGCGGCGCCGACGACACTCAAACGCACTGGAATCTGGACTCCCTCGTCCACGATTTGAGCTTCATTTGT CTTTTCGGAATTCACGACGCCATCCGGCCCGGTGTCCCCCAGGCTGTGGAAGCCTGCGGCGAGGCCGGTATCACC GTACGCATGGTGACGGGCGACAACGTCCAGACTGCCAGAGCGGTTGCGACTCACTGCGGCATCCTTTCGTATAGC AGGGGTGATCTGAGCATGGAAGGGCTCGAATTCAGGGCCATGAGTGATGTGCAGGCCATGGAGATGCTCCCTCGC CTCAAGGTGCTTGCCAGGTCCAGCCCTCAAGACAAGCAGAGGCTGGTTGCTTTGTTGAAAGAAATGGGACGAACA GTAGCCGTCACCGGCGACGGGACAAACGATGTCGCGGCGCTCAGCACGGCCGATGTCAGCTTTGCAATGGGTGGC AATTCCGGAACCGAGGTTGCCAGGGAGGCGTCTTCCATCATCTTGACGAATGACGATTTCACCTCGATTATACGA GCGATTCTATGGGGAAGAGCCATTAATGACTCGGAACGCTAA |
Transcript | >Hirsu2|1603 ATGGCTCGTAGGACACCCGCCTTGCTTTCTCCCGAGGAGCTGAGCGCCCTTCACGGCCCCGGCCCCGACATCGAC AACCTAGCGGCGCTAGGCCGGCTCGGAGGCCTCGGCGGCCTCGAGAGCGGGCTGCGAACCAGCCTCGAGAGCGGC CTGGATGCCTGCGAAACCAGCCTCGACCGTGGCGTCCCGGGCAAGGCTGAAGCAGCCCGTCCGCGGCCGCCCGAC GCCGCGCTCTTCGCCGAACGCAGGCGCCGCTTTCTCGATAACCAACTGCCGACTAAGAGGCAGCCGACCTTTGTC CAGCTGCTCTGGCGCTCCTACAACGACCCGGCCCTCTTTCTGCTGACGGCCGCCGCTGTCGCCTCGCTCGCCGTC GACCTATACCAGACACTGGGCACCGCTCACTCAGCCGCCAATCCGCCCGTCGAATGGGTGCAGGGAGTCGCCATC CTCGTCGCCATCCTCGTTATTGTCCTCGTCAGCTCCGTCAACGACTGGGGCAAGCAGCGCCAGTTCCGGAAACTC AGCCGGCGTCAGCTGCAGCGCGACATCAAAGTCGTTCGCTCTGCTGCCCTGCGCCTTATCCCCATCTCTGAGCTG GTCGTCGGCGATGTCGCTCAGCTCGAGCCCGGCGACGTCGTACCAGCCGATGGCGTCCTCATTTCTGGCCAGAAC CTCTCATGCGACGAGGCGGCGGTAACCGGTGAGAGTGACTTGGTCCTGAAGACGCCTGGCCACGCCGCTCTCGCC GCCCTCTCGAGCAGCGAGCCGCCGCGCCGCAGCCTCCTCGATCCCTTTCTTCGCTCGGGCACACGGGTGCTCGAT GGCGTCGGCACGTTTCTTGTCACCGCCACAGGCATCAACTCCACCTATGGCCAGGTCCTGGCCTCGGTCAGAGAT GAGCCCGAGCCCACGCCTCTGCAGGTCCGCCTCACGGCCGTCACCAAGGTCATCGCCCACGCCGGCGGCTTCTTT GCCCTCTTTCTCTTTGTTGTCCTCTTCGTCAAGTTCCTCGCCAGGCTCCCGTACGATGCAGGAACACCGGTCGCC AAAGGCAGAGACTTTGTCAGCATTGTCATCATTGCCGTGACCGTGCTGGTCATAGCCGTCCCCGAAGGCCTCCCC CTCGCCGTCACGCTGTCCCTGGCCATCGCTTCGATAAGAATGATGAAGGACAACAACCTGGTTCGGCAACTGAAG GCCTGCGAGACCATGGGAAACGCCACGGATGTCTGCTCCGACAAGACTGGAACGCTGACCCAGAATCGTATGACC GTCGTCAACTGCACTGTTGGCGCCGATATGCAGTTTCACGATCCGGCCCTGGCTCCCAACCTACCCGACTCGCGT TCGGCCACAGTGCAGGGGACTGGAAATTCTCCTGCCCGCCTTGAACAGGTTGCTCTCAAGCTTGCTCCCGATGTC AAGTTCATGCTCCGCCAATCGATTTCCCTTAACTCGATGGCTTTTGAGGCGAGAGACGCCCCGGCCTTCGTCGGG TCCAGCACCGAGTCCGCTCTTCTGCACTTTGCCAGACGTCATCTGGCCATGGGGCCGGTAGGGTCGGAGCGGTCT GCAGCAGGCGTCATACAACTCATCCCTTTCAATGCCGCGCGGCAGTGCATGGCAACCGTCGTCAGACTGCCCGGC AGCAATACCCGATGTAGGGTCTTGGTCAAGGGCGCTTCCGAGATCTTACTGTCGAGATGTTCCACAGTCATCCGC GATCCCAAACGGGGCTGCCAAGTTACGGAGATGACGAGCCAGGCGCGGCAAGGGCTATCTGACACCATCGACAGT TACGCCGGCCACGCCCTTCGGACAATCACTCTAGCATTCCGCGACTTAGATCTCGACCACACTGAGTACGTAACG TCCAGAGGCGGCGCCGACGACACTCAAACGCACTGGAATCTGGACTCCCTCGTCCACGATTTGAGCTTCATTTGT CTTTTCGGAATTCACGACGCCATCCGGCCCGGTGTCCCCCAGGCTGTGGAAGCCTGCGGCGAGGCCGGTATCACC GTACGCATGGTGACGGGCGACAACGTCCAGACTGCCAGAGCGGTTGCGACTCACTGCGGCATCCTTTCGTATAGC AGGGGTGATCTGAGCATGGAAGGGCTCGAATTCAGGGCCATGAGTGATGTGCAGGCCATGGAGATGCTCCCTCGC CTCAAGGTGCTTGCCAGGTCCAGCCCTCAAGACAAGCAGAGGCTGGTTGCTTTGTTGAAAGAAATGGGACGAACA GTAGCCGTCACCGGCGACGGGACAAACGATGTCGCGGCGCTCAGCACGGCCGATGTCAGCTTTGCAATGGGTGGC AATTCCGGAACCGAGGTTGCCAGGGAGGCGTCTTCCATCATCTTGACGAATGACGATTTCACCTCGATTATACGA GCGATTCTATGGGGAAGAGCCATTAATGACTCGGAACGCTAA |
Gene | >Hirsu2|1603 ATGGCTCGTAGGACACCCGCCTTGCTTTCTCCCGAGGAGCTGAGCGCCCTTCACGGCCCCGGCCCCGACATCGAC AACCTAGCGGCGCTAGGCCGGCTCGGAGGCCTCGGCGGCCTCGAGAGCGGGCTGCGAACCAGCCTCGAGAGCGGC CTGGATGCCTGCGAAACCAGCCTCGACCGTGGCGTCCCGGGCAAGGCTGAAGCAGCCCGTCCGCGGCCGCCCGAC GCCGCGCTCTTCGCCGAACGCAGGCGCCGCTTTCTCGATAACCAACTGCCGACTAAGAGGCAGCCGACCTTTGTC CAGCTGCTCTGGCGCTCCTACAACGACCCGGCCCTCTTTCTGCTGACGGCCGCCGCTGTCGCCTCGCTCGCCGTC GACCTATACCAGACACTGGGCACCGCTCACTCAGCCGCCAATCCGCCCGTCGAATGGGTGCAGGGAGTCGCCATC CTCGTCGCCATCCTCGTTATTGTCCTCGTCAGCTCCGTCAACGACTGGGGCAAGCAGCGCCAGTTCCGGAAACTC AGCCGGCGTCAGCTGCAGCGCGACATCAAAGTCGTTCGCTCTGCTGCCCTGCGCCTTATCCCCATCTCTGAGCTG GTCGTCGGCGATGTCGCTCAGCTCGAGCCCGGCGACGTCGTACCAGCCGATGGCGTCCTCATTTCTGGCCAGAAC CTCTCATGCGACGAGGCGGCGGTAACCGGTGAGAGTGACTTGGTCCTGAAGACGCCTGGCCACGCCGCTCTCGCC GCCCTCTCGAGCAGCGAGCCGCCGCGCCGCAGCCTCCTCGATCCCTTTCTTCGCTCGGGCACACGGGTGCTCGAT GGCGTCGGCACGTTTCTTGTCACCGCCACAGGCATCAACTCCACCTATGGCCAGGTCCTGGCCTCGGTCAGAGAT GAGCCCGAGCCCACGCCTCTGCAGGTCCGCCTCACGGCCGTCACCAAGGTCATCGCCCACGCCGGCGGCTTCTTT GCCCTCTTTCTCTTTGTTGTCCTCTTCGTCAAGTTCCTCGCCAGGCTCCCGTACGATGCAGGAACACCGGTCGCC AAAGGCAGAGACTTTGTCAGCATTGTCATCATTGCCGTGACCGTGCTGGTCATAGCCGTCCCCGAAGGCCTCCCC CTCGCCGTCACGCTGTCCCTGGCCATCGCTTCGATAAGAATGATGAAGGACAACAACCTGGTTCGGCAACTGAAG GCCTGCGAGACCATGGGAAACGCCACGGATGTCTGCTCCGACAAGACTGGAACGCTGACCCAGAATCGTATGACC GTCGTCAACTGCACTGTTGGCGCCGATATGCAGTTTCACGATCCGGCCCTGGCTCCCAACCTACCCGACTCGCGT TCGGCCACAGTGCAGGGGACTGGAAATTCTCCTGCCCGCCTTGAACAGGTTGCTCTCAAGCTTGCTCCCGATGTC AAGTTCATGCTCCGCCAATCGATTTCCCTTAACTCGATGGCTTTTGAGGCGAGAGACGCCCCGGCCTTCGTCGGG TCCAGCACCGAGTCCGCTCTTCTGCACTTTGCCAGACGTCATCTGGCCATGGGGCCGGTAGGGTCGGAGCGGTCT GCAGCAGGCGTCATACAACTCATCCCTTTCAATGCCGCGCGGCAGTGCATGGCAACCGTCGTCAGACTGCCCGGC AGCAATACCCGATGTAGGGTCTTGGTCAAGGGCGCTTCCGAGATCTTACTGTCGAGATGTTCCACAGTCATCCGC GATCCCAAACGGGGCTGCCAAGTTACGGAGATGACGAGCCAGGCGCGGCAAGGGCTATCTGACACCATCGACAGT TACGCCGGCCACGCCCTTCGGACAATCACTCTAGCATTCCGCGACTTAGATCTCGACCACACTGAGTACGTAACG TCCAGAGGCGGCGCCGACGACACTCAAACGCACTGGAATCTGGACTCCCTCGTCCACGATTTGAGCTTCATTTGT CTTTTCGGAATTCACGACGCCATCCGGCCCGGTGTCCCCCAGGCTGTGGAAGCCTGCGGCGAGGCCGGTATCACC GTACGCATGGTGACGGGCGACAACGTCCAGACTGCCAGAGCGGTTGCGACTCACTGCGGCATCCTTTCGTATAGC AGGGGTGATCTGAGCATGGAAGGGCTCGAATTCAGGGCCATGAGTGATGTGCAGGCCATGGAGATGCTCCCTCGC CTCAAGGTGCTTGCCAGGTCCAGCCCTCAAGACAAGCAGAGGCTGGTTGCTTTGTTGAAAGAAATGGGACGAACA GTAGCCGTCACCGGCGACGGGACAAACGATGTCGCGGCGCTCAGCACGGCCGATGTCAGCTTTGCAATGGGTGGC AATTCCGGAACCGAGGTTGCCAGGGAGGCGTCTTCCATCATCTTGACGAATGACGATTTCACCTCGATTATACGA GCGATTCTATGGGGAAGAGCCATTAATGACTCGGTCAGGAAGTTTTTACAGGCATGTATTCGGACGGGTCCCTTG GCAACCCTCCGATCTAGGAACGCTAA |