Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1594
Gene name
LocationContig_1355:4244..6767
Strand+
Gene length (bp)2523
Transcript length (bp)2340
Coding sequence length (bp)2340
Protein length (aa) 780

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02366 PMT Dolichyl-phosphate-mannose-protein mannosyltransferase 2.3E-79 59 307
PF16192 PMT_4TMC C-terminal four TMM region of protein-O-mannosyltransferase 8.3E-67 557 755
PF02815 MIR MIR domain 4.6E-45 355 533

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74189|PMT1_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT1 PE=2 SV=1 62 769 0.0E+00
sp|P33775|PMT1_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT1 PE=1 SV=1 58 778 0.0E+00
sp|P52867|PMT5_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT5 PE=1 SV=1 62 761 2.0E-162
sp|O13898|PMT1_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm1 PE=1 SV=1 53 767 4.0E-147
sp|Q5ACU3|PMT5_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT5 PE=2 SV=1 57 762 7.0E-138
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74189|PMT1_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT1 PE=2 SV=1 62 769 0.0E+00
sp|P33775|PMT1_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT1 PE=1 SV=1 58 778 0.0E+00
sp|P52867|PMT5_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT5 PE=1 SV=1 62 761 2.0E-162
sp|O13898|PMT1_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm1 PE=1 SV=1 53 767 4.0E-147
sp|Q5ACU3|PMT5_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT5 PE=2 SV=1 57 762 7.0E-138
sp|P31382|PMT2_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT2 PE=1 SV=2 48 756 1.0E-129
sp|Q9UKY4|POMT2_HUMAN Protein O-mannosyl-transferase 2 OS=Homo sapiens GN=POMT2 PE=1 SV=2 59 738 2.0E-128
sp|P47190|PMT3_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT3 PE=1 SV=2 55 738 1.0E-123
sp|Q8BGQ4|POMT2_MOUSE Protein O-mannosyl-transferase 2 OS=Mus musculus GN=Pomt2 PE=1 SV=1 59 738 3.0E-123
sp|Q5ADM9|PMT2_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT2 PE=1 SV=1 39 755 1.0E-119
sp|Q29IL2|POMT2_DROPS Protein O-mannosyl-transferase 2 OS=Drosophila pseudoobscura pseudoobscura GN=tw PE=3 SV=1 1 738 1.0E-118
sp|Q9W5D4|POMT2_DROME Protein O-mannosyl-transferase 2 OS=Drosophila melanogaster GN=tw PE=2 SV=1 54 638 2.0E-109
sp|Q59X23|PMT4_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT4 PE=2 SV=1 68 750 1.0E-108
sp|Q9C100|PMT2_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm2 PE=3 SV=1 54 756 2.0E-106
sp|Q9VTK2|POMT1_DROME Protein O-mannosyltransferase 1 OS=Drosophila melanogaster GN=rt PE=2 SV=2 17 757 4.0E-106
sp|P46971|PMT4_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT4 PE=1 SV=1 59 739 4.0E-105
sp|Q5A688|PMT6_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT6 PE=2 SV=1 58 755 5.0E-104
sp|P42934|PMT6_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT6 PE=1 SV=1 7 756 1.0E-101
sp|Q2LZ62|POMT1_DROPS Protein O-mannosyltransferase 1 OS=Drosophila pseudoobscura pseudoobscura GN=rt PE=3 SV=2 62 763 5.0E-101
sp|O42933|PMT4_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm4 PE=3 SV=1 1 755 1.0E-98
sp|Q9Y6A1|POMT1_HUMAN Protein O-mannosyl-transferase 1 OS=Homo sapiens GN=POMT1 PE=1 SV=3 52 756 2.0E-96
sp|Q99PR0|POMT1_RAT Protein O-mannosyl-transferase 1 OS=Rattus norvegicus GN=Pomt1 PE=2 SV=1 60 756 5.0E-94
sp|Q8R2R1|POMT1_MOUSE Protein O-mannosyl-transferase 1 OS=Mus musculus GN=Pomt1 PE=1 SV=1 75 756 2.0E-92
sp|Q06644|PMT7_YEAST Probable dolichyl-phosphate-mannose--protein mannosyltransferase 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT7 PE=1 SV=1 133 698 8.0E-26
sp|Q93ZE8|SDF2_ARATH Stromal cell-derived factor 2-like protein OS=Arabidopsis thaliana GN=SDF2 PE=1 SV=1 337 533 2.0E-09
sp|Q3T083|SDF2L_BOVIN Stromal cell-derived factor 2-like protein 1 OS=Bos taurus GN=SDF2L1 PE=2 SV=1 329 467 1.0E-07
sp|Q54P23|SDF2_DICDI Stromal cell-derived factor 2-like protein OS=Dictyostelium discoideum GN=DDB_G0284847 PE=3 SV=1 338 500 1.0E-07
sp|Q9W5D4|POMT2_DROME Protein O-mannosyl-transferase 2 OS=Drosophila melanogaster GN=tw PE=2 SV=1 659 738 7.0E-07
sp|Q9HCN8|SDF2L_HUMAN Stromal cell-derived factor 2-like protein 1 OS=Homo sapiens GN=SDF2L1 PE=1 SV=2 356 467 2.0E-06
sp|Q9ESP1|SDF2L_MOUSE Stromal cell-derived factor 2-like protein 1 OS=Mus musculus GN=Sdf2l1 PE=1 SV=2 356 467 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0006493 protein O-linked glycosylation Yes
GO:0000030 mannosyltransferase activity Yes
GO:0006464 cellular protein modification process No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006486 protein glycosylation No
GO:0016758 transferase activity, transferring hexosyl groups No
GO:0003824 catalytic activity No
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0019538 protein metabolic process No
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043413 macromolecule glycosylation No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0044267 cellular protein metabolic process No
GO:0070085 glycosylation No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 97 119 22
2 139 161 22
3 163 180 17
4 190 212 22
5 225 242 17
6 246 268 22
7 281 303 22
8 611 633 22
9 654 671 17
10 676 698 22
11 711 733 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1594
MVRSNGNRPKSPQPSPVDRQLSGTSSKAKAKKGASYKSDGVEDNDVFLLPASDYVVALVVTLLATMVRIFRIYQP
SSVVFDEVHFGGFASKYIKGRFFMDVHPPLAKMLIALTGWLAGFDGNFDFKDIGKDYVEPGVPYVAMRLFPAVCG
IALAPFMFLTLKAVGCRTMTATMGAGFIIFENGLLTQARLILLDSPLVAATAFTVLAFSCFTNQHEQGPAKAFSP
AWWFWLAMTGLGLGVTASIKWVGLFTIAWVGALTLVQLWVLLGDNRNVTLRLWTKHLMARAFCLIAIPITFYLAM
FAIHFVCLVNPGDGDGFMSSEFQATLNSKGMKDVAADVALGSRVTIRHVNTQGGYLHSHPLMYPTGSKQQQITLY
PHKDENNVWLLENQTQPLGPDGQPINGTDAWSKLADGPHYVTDGMILRLYHQPTHRRLHSHDVRPPITEADWQNE
VSAYGFDGFEGDANDLFRLEIVKKKSTGTAAKERLRTIETKFKLVHIMSGCVLFSHKVKLPEWASEQQEVTCAKS
GSLPNSLWYVEYNEHPQLGGDVEKVNYRNPGFFGKFWELQQVMWRTNAGLVESHAWDSRPESWPIMRRGINFWGK
HHTQIYLIGNPIVWWSSTLAVVVWVLFKAVAVLRWQRSYNDYSCNTFKRFDYEIGTYVLGWALHYFPFYLMQRQL
FLHHYFPALYFAIVALCQMLDYLTARIPTVGAREGAIVNRTATVCFLVLSVAAFTLYAPLAYGNRWTRGECSRVK
LFNTWDWDCNNFYNSVSVFCLFRNPSSPP*
Coding >Hirsu2|1594
ATGGTCAGATCAAACGGCAACCGGCCCAAGAGCCCGCAGCCGTCGCCCGTCGACCGACAGCTCTCCGGAACGTCG
AGCAAGGCCAAGGCCAAGAAGGGCGCCTCGTACAAGTCGGACGGCGTCGAGGACAACGATGTCTTCCTGCTGCCC
GCCTCCGACTACGTCGTCGCCCTCGTCGTGACGCTGCTGGCCACCATGGTCCGAATCTTCAGGATTTACCAGCCC
AGCAGCGTCGTCTTCGACGAGGTCCACTTCGGCGGCTTTGCCTCCAAATACATCAAGGGCCGCTTCTTCATGGAC
GTCCATCCTCCCCTCGCCAAGATGCTCATCGCCCTCACCGGATGGCTCGCCGGCTTTGACGGCAATTTCGACTTC
AAGGATATCGGCAAGGACTACGTCGAGCCCGGCGTGCCCTACGTCGCCATGCGCTTGTTCCCGGCCGTCTGTGGC
ATTGCCCTGGCTCCCTTCATGTTCCTGACGCTCAAGGCCGTCGGCTGCCGCACCATGACGGCCACCATGGGTGCC
GGCTTCATCATCTTCGAGAACGGCCTCCTGACCCAGGCTCGCCTGATCCTTCTCGACTCGCCGCTCGTCGCCGCC
ACCGCCTTCACCGTCCTCGCCTTTTCCTGCTTCACGAACCAACACGAACAAGGTCCGGCCAAGGCCTTCAGCCCG
GCCTGGTGGTTCTGGCTGGCCATGACCGGTCTCGGCCTGGGCGTGACGGCCAGCATCAAATGGGTCGGTCTCTTC
ACCATCGCCTGGGTTGGCGCCTTGACCCTGGTGCAGCTGTGGGTGCTCCTCGGCGACAACCGCAACGTGACCCTG
CGGCTCTGGACGAAGCACCTCATGGCCAGGGCCTTCTGTCTCATCGCCATTCCCATCACCTTCTACCTCGCCATG
TTCGCCATTCACTTTGTCTGCCTGGTCAACCCCGGCGACGGCGACGGCTTCATGAGCTCCGAGTTCCAGGCAACG
CTCAACAGCAAGGGCATGAAGGATGTCGCCGCCGACGTCGCCCTCGGCAGCCGTGTCACCATCCGCCACGTCAAC
ACCCAGGGTGGCTATCTCCACTCCCACCCGCTCATGTACCCGACCGGCAGCAAGCAGCAGCAGATCACCCTGTAT
CCTCACAAGGACGAGAACAACGTCTGGCTCCTCGAGAACCAGACCCAGCCCCTGGGACCCGACGGCCAACCAATC
AACGGCACCGATGCATGGAGCAAGCTTGCTGATGGGCCTCACTACGTGACCGACGGCATGATCCTCCGACTCTAC
CACCAGCCCACGCACCGCCGGCTGCACTCGCACGACGTGCGACCGCCCATCACCGAGGCGGACTGGCAAAACGAA
GTGTCTGCCTACGGCTTCGATGGTTTCGAGGGCGACGCCAACGACCTCTTCCGCCTGGAAATCGTCAAGAAGAAG
TCCACGGGGACCGCGGCAAAGGAGCGCCTCCGGACCATCGAGACCAAGTTCAAGCTTGTCCACATCATGTCCGGC
TGCGTCCTCTTCTCCCACAAAGTCAAGCTTCCCGAGTGGGCCTCGGAGCAGCAGGAGGTGACATGCGCCAAGAGC
GGCTCGCTGCCCAACAGCCTGTGGTACGTCGAGTACAACGAACACCCCCAGCTCGGCGGCGACGTGGAAAAGGTC
AACTACCGCAACCCGGGCTTCTTTGGCAAGTTCTGGGAGCTCCAGCAGGTCATGTGGCGCACCAACGCGGGCCTG
GTCGAGTCCCACGCCTGGGACTCGCGGCCCGAGTCGTGGCCCATCATGCGCCGCGGCATCAACTTCTGGGGGAAG
CACCACACCCAGATCTACCTCATCGGCAACCCCATCGTCTGGTGGTCCTCGACCCTGGCCGTCGTCGTCTGGGTC
CTCTTCAAGGCCGTCGCCGTCCTGCGATGGCAGCGCAGCTACAACGACTACTCCTGCAACACCTTCAAGCGATTC
GACTACGAGATCGGCACCTACGTCCTCGGCTGGGCGCTGCACTACTTCCCCTTTTATCTGATGCAGCGCCAGCTG
TTCCTGCACCACTACTTCCCGGCCCTGTACTTCGCCATCGTGGCCCTCTGCCAGATGCTGGACTACCTCACCGCC
AGGATCCCCACTGTCGGGGCCCGCGAGGGCGCCATCGTCAACCGGACGGCAACCGTCTGTTTCCTCGTCCTCTCA
GTCGCCGCGTTCACTCTGTACGCCCCTCTGGCCTACGGCAACCGATGGACGCGCGGCGAGTGCAGCCGGGTGAAG
CTGTTCAACACCTGGGACTGGGACTGCAACAACTTCTACAACTCGGTAAGTGTCTTTTGTCTTTTCCGCAATCCG
TCCAGTCCACCGTAA
Transcript >Hirsu2|1594
ATGGTCAGATCAAACGGCAACCGGCCCAAGAGCCCGCAGCCGTCGCCCGTCGACCGACAGCTCTCCGGAACGTCG
AGCAAGGCCAAGGCCAAGAAGGGCGCCTCGTACAAGTCGGACGGCGTCGAGGACAACGATGTCTTCCTGCTGCCC
GCCTCCGACTACGTCGTCGCCCTCGTCGTGACGCTGCTGGCCACCATGGTCCGAATCTTCAGGATTTACCAGCCC
AGCAGCGTCGTCTTCGACGAGGTCCACTTCGGCGGCTTTGCCTCCAAATACATCAAGGGCCGCTTCTTCATGGAC
GTCCATCCTCCCCTCGCCAAGATGCTCATCGCCCTCACCGGATGGCTCGCCGGCTTTGACGGCAATTTCGACTTC
AAGGATATCGGCAAGGACTACGTCGAGCCCGGCGTGCCCTACGTCGCCATGCGCTTGTTCCCGGCCGTCTGTGGC
ATTGCCCTGGCTCCCTTCATGTTCCTGACGCTCAAGGCCGTCGGCTGCCGCACCATGACGGCCACCATGGGTGCC
GGCTTCATCATCTTCGAGAACGGCCTCCTGACCCAGGCTCGCCTGATCCTTCTCGACTCGCCGCTCGTCGCCGCC
ACCGCCTTCACCGTCCTCGCCTTTTCCTGCTTCACGAACCAACACGAACAAGGTCCGGCCAAGGCCTTCAGCCCG
GCCTGGTGGTTCTGGCTGGCCATGACCGGTCTCGGCCTGGGCGTGACGGCCAGCATCAAATGGGTCGGTCTCTTC
ACCATCGCCTGGGTTGGCGCCTTGACCCTGGTGCAGCTGTGGGTGCTCCTCGGCGACAACCGCAACGTGACCCTG
CGGCTCTGGACGAAGCACCTCATGGCCAGGGCCTTCTGTCTCATCGCCATTCCCATCACCTTCTACCTCGCCATG
TTCGCCATTCACTTTGTCTGCCTGGTCAACCCCGGCGACGGCGACGGCTTCATGAGCTCCGAGTTCCAGGCAACG
CTCAACAGCAAGGGCATGAAGGATGTCGCCGCCGACGTCGCCCTCGGCAGCCGTGTCACCATCCGCCACGTCAAC
ACCCAGGGTGGCTATCTCCACTCCCACCCGCTCATGTACCCGACCGGCAGCAAGCAGCAGCAGATCACCCTGTAT
CCTCACAAGGACGAGAACAACGTCTGGCTCCTCGAGAACCAGACCCAGCCCCTGGGACCCGACGGCCAACCAATC
AACGGCACCGATGCATGGAGCAAGCTTGCTGATGGGCCTCACTACGTGACCGACGGCATGATCCTCCGACTCTAC
CACCAGCCCACGCACCGCCGGCTGCACTCGCACGACGTGCGACCGCCCATCACCGAGGCGGACTGGCAAAACGAA
GTGTCTGCCTACGGCTTCGATGGTTTCGAGGGCGACGCCAACGACCTCTTCCGCCTGGAAATCGTCAAGAAGAAG
TCCACGGGGACCGCGGCAAAGGAGCGCCTCCGGACCATCGAGACCAAGTTCAAGCTTGTCCACATCATGTCCGGC
TGCGTCCTCTTCTCCCACAAAGTCAAGCTTCCCGAGTGGGCCTCGGAGCAGCAGGAGGTGACATGCGCCAAGAGC
GGCTCGCTGCCCAACAGCCTGTGGTACGTCGAGTACAACGAACACCCCCAGCTCGGCGGCGACGTGGAAAAGGTC
AACTACCGCAACCCGGGCTTCTTTGGCAAGTTCTGGGAGCTCCAGCAGGTCATGTGGCGCACCAACGCGGGCCTG
GTCGAGTCCCACGCCTGGGACTCGCGGCCCGAGTCGTGGCCCATCATGCGCCGCGGCATCAACTTCTGGGGGAAG
CACCACACCCAGATCTACCTCATCGGCAACCCCATCGTCTGGTGGTCCTCGACCCTGGCCGTCGTCGTCTGGGTC
CTCTTCAAGGCCGTCGCCGTCCTGCGATGGCAGCGCAGCTACAACGACTACTCCTGCAACACCTTCAAGCGATTC
GACTACGAGATCGGCACCTACGTCCTCGGCTGGGCGCTGCACTACTTCCCCTTTTATCTGATGCAGCGCCAGCTG
TTCCTGCACCACTACTTCCCGGCCCTGTACTTCGCCATCGTGGCCCTCTGCCAGATGCTGGACTACCTCACCGCC
AGGATCCCCACTGTCGGGGCCCGCGAGGGCGCCATCGTCAACCGGACGGCAACCGTCTGTTTCCTCGTCCTCTCA
GTCGCCGCGTTCACTCTGTACGCCCCTCTGGCCTACGGCAACCGATGGACGCGCGGCGAGTGCAGCCGGGTGAAG
CTGTTCAACACCTGGGACTGGGACTGCAACAACTTCTACAACTCGGTAAGTGTCTTTTGTCTTTTCCGCAATCCG
TCCAGTCCACCGTAA
Gene >Hirsu2|1594
ATGGTCAGATCAAACGGCAACCGGCCCAAGAGCCCGCAGCCGTCGCCCGTCGACCGACAGCTCTCCGGAACGTCG
AGCAAGGCCAAGGCCAAGAAGGGCGCCTCGTACAAGTCGGACGGCGTCGAGGACAACGATGTCTTCCTGCTGCCC
GCCTCCGACTACGTCGTCGCCCTCGTCGTGACGCTGCTGGCCACCATGGTCCGAATCTTCAGGATTTACCAGCCC
AGCAGCGTCGTCTTCGACGAGGTCCAGTACGTCCCGCCCCAACTGTGGCCGCCCACGCTGCCTGCTGGCTAACCG
CTCCGCCTCGCTGTCCAGCTTCGGCGGCTTTGCCTCCAAATACATCAAGGGCCGCTTCTTCATGGACGTCCATCC
TCCCCTCGCCAAGATGCTCATCGCCCTCACCGGATGGCTCGCCGGCTTTGACGGCAATTTCGACTTCAAGGATAT
CGGCAAGGACTACGTCGAGCCCGGCGTGCCCTACGTCGCCATGCGCTTGTTCCCGGCCGTCTGTGGCATTGCCCT
GGCTCCCTTCATGTTCCTGACGCTCAAGGCCGTCGGCTGCCGCACCATGACGGCCACCATGGGTGCCGGCTTCAT
CATCTTCGGTAAGTTTGGCCCGTCTTGCCTTGAGCCGCTTCTCGTCTGACCTGCCTCCCATCGTGCAGAGAACGG
CCTCCTGACCCAGGCTCGCCTGATCCTTCTCGACTCGCCGCTCGTCGCCGCCACCGCCTTCACCGTCCTCGCCTT
TTCCTGCTTCACGAACCAACACGAACAAGGTCCGGCCAAGGCCTTCAGCCCGGCCTGGTGGTTCTGGCTGGCCAT
GACCGGTCTCGGCCTGGGCGTGACGGCCAGCATCAAATGGGTCGGTCTCTTCACCATCGCCTGGGTTGGCGCCTT
GACCCTGGTGCAGCTGTGGGTGCTCCTCGGCGACAACCGCAACGTGACCCTGGTAAGGCCACCCCTCCGGCAGCC
TCCCGTTCCGTCATTTCGCTGACCCTACCGCAGCGGCTCTGGACGAAGCACCTCATGGCCAGGGCCTTCTGTCTC
ATCGCCATTCCCATCACCTTCTACCTCGCCATGTTCGCCATTCACTTTGTCTGCCTGGTCAACCCCGGCGACGGC
GACGGCTTCATGAGCTCCGAGTTCCAGGCAACGCTCAACAGCAAGGGCATGAAGGATGTCGCCGCCGACGTCGCC
CTCGGCAGCCGTGTCACCATCCGCCACGTCAACACCCAGGGTGGCTATCTCCACTCCCACCCGCTCATGTACCCG
ACCGGCAGCAAGCAGCAGCAGATCACCCTGTATCCTCACAAGGACGAGAACAACGTCTGGCTCCTCGAGAACCAG
ACCCAGCCCCTGGGACCCGACGGCCAACCAATCAACGGCACCGATGCATGGAGCAAGCTTGCTGATGGGCCTCAC
TACGTGACCGACGGCATGATCCTCCGACTCTACCACCAGCCCACGCACCGCCGGCTGCACTCGCACGACGTGCGA
CCGCCCATCACCGAGGCGGACTGGCAAAACGAAGTGTCTGCCTACGGCTTCGATGGTTTCGAGGGCGACGCCAAC
GACCTCTTCCGCCTGGAAATCGTCAAGAAGAAGTCCACGGGGACCGCGGCAAAGGAGCGCCTCCGGACCATCGAG
ACCAAGTTCAAGCTTGTCCACATCATGTCCGGCTGCGTCCTCTTCTCCCACAAAGTCAAGCTTCCCGAGTGGGCC
TCGGAGCAGCAGGAGGTGACATGCGCCAAGAGCGGCTCGCTGCCCAACAGCCTGTGGTACGTCGAGTACAACGAA
CACCCCCAGCTCGGCGGCGACGTGGAAAAGGTCAACTACCGCAACCCGGGCTTCTTTGGCAAGTTCTGGGAGCTC
CAGCAGGTCATGTGGCGCACCAACGCGGGCCTGGTCGAGTCCCACGCCTGGGACTCGCGGCCCGAGTCGTGGCCC
ATCATGCGCCGCGGCATCAACTTCTGGGGGAAGCACCACACCCAGATCTACCTCATCGGCAACCCCATCGTCTGG
TGGTCCTCGACCCTGGCCGTCGTCGTCTGGGTCCTCTTCAAGGCCGTCGCCGTCCTGCGATGGCAGCGCAGCTAC
AACGACTACTCCTGCAACACCTTCAAGCGATTCGACTACGAGATCGGCACCTACGTCCTCGGCTGGGCGCTGCAC
TACTTCCCCTTTTATCTGATGCAGCGCCAGCTGTTCCTGCACCACTACTTCCCGGCCCTGTACTTCGCCATCGTG
GCCCTCTGCCAGATGCTGGACTACCTCACCGCCAGGATCCCCACTGTCGGGGCCCGCGAGGGCGCCATCGTCAAC
CGGACGGCAACCGTCTGTTTCCTCGTCCTCTCAGTCGCCGCGTTCACTCTGTACGCCCCTCTGGCCTACGGCAAC
CGATGGACGCGCGGCGAGTGCAGCCGGGTGAAGCTGTTCAACACCTGGGACTGGGACTGCAACAACTTCTACAAC
TCGGTAAGTGTCTTTTGTCTTTTCCGCAATCCGTCCAGTCCACCGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail