Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1593
Gene name
LocationContig_1355:1001..2695
Strand-
Gene length (bp)1694
Transcript length (bp)1632
Coding sequence length (bp)1632
Protein length (aa) 544

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12230 PRP21_like_P Pre-mRNA splicing factor PRP21 like protein 8.8E-52 204 474
PF01805 Surp Surp module 8.5E-18 31 81
PF01805 Surp Surp module 4.2E-15 130 180

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13900|SA114_SCHPO Pre-mRNA-splicing factor sap114 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap114 PE=1 SV=1 20 505 1.0E-75
sp|Q15459|SF3A1_HUMAN Splicing factor 3A subunit 1 OS=Homo sapiens GN=SF3A1 PE=1 SV=1 9 276 7.0E-52
sp|A2VDN6|SF3A1_BOVIN Splicing factor 3A subunit 1 OS=Bos taurus GN=SF3A1 PE=2 SV=1 9 276 8.0E-51
sp|Q8K4Z5|SF3A1_MOUSE Splicing factor 3A subunit 1 OS=Mus musculus GN=Sf3a1 PE=1 SV=1 18 276 1.0E-50
sp|Q8RXF1|SF3A1_ARATH Probable splicing factor 3A subunit 1 OS=Arabidopsis thaliana GN=At1g14650 PE=1 SV=2 22 276 4.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13900|SA114_SCHPO Pre-mRNA-splicing factor sap114 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap114 PE=1 SV=1 20 505 1.0E-75
sp|Q15459|SF3A1_HUMAN Splicing factor 3A subunit 1 OS=Homo sapiens GN=SF3A1 PE=1 SV=1 9 276 7.0E-52
sp|A2VDN6|SF3A1_BOVIN Splicing factor 3A subunit 1 OS=Bos taurus GN=SF3A1 PE=2 SV=1 9 276 8.0E-51
sp|Q8K4Z5|SF3A1_MOUSE Splicing factor 3A subunit 1 OS=Mus musculus GN=Sf3a1 PE=1 SV=1 18 276 1.0E-50
sp|Q8RXF1|SF3A1_ARATH Probable splicing factor 3A subunit 1 OS=Arabidopsis thaliana GN=At1g14650 PE=1 SV=2 22 276 4.0E-39
sp|Q86A14|SF3A1_DICDI Probable splicing factor 3A subunit 1 OS=Dictyostelium discoideum GN=sf3a1 PE=3 SV=1 128 276 4.0E-14
sp|P32524|PRP21_YEAST Pre-mRNA-splicing factor PRP21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP21 PE=1 SV=1 29 277 2.0E-12
sp|Q8RXF1|SF3A1_ARATH Probable splicing factor 3A subunit 1 OS=Arabidopsis thaliana GN=At1g14650 PE=1 SV=2 391 500 3.0E-10
sp|A2VDN6|SF3A1_BOVIN Splicing factor 3A subunit 1 OS=Bos taurus GN=SF3A1 PE=2 SV=1 395 532 1.0E-08
sp|Q15459|SF3A1_HUMAN Splicing factor 3A subunit 1 OS=Homo sapiens GN=SF3A1 PE=1 SV=1 395 532 2.0E-08
sp|Q8K4Z5|SF3A1_MOUSE Splicing factor 3A subunit 1 OS=Mus musculus GN=Sf3a1 PE=1 SV=1 395 532 2.0E-08
sp|P12297|SUWA_DROME Protein suppressor of white apricot OS=Drosophila melanogaster GN=su(w[a]) PE=1 SV=3 25 80 2.0E-06
sp|Q86A14|SF3A1_DICDI Probable splicing factor 3A subunit 1 OS=Dictyostelium discoideum GN=sf3a1 PE=3 SV=1 29 84 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006396 RNA processing Yes
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003676 nucleic acid binding No
GO:0016070 RNA metabolic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1593
MAASAANGEASSVLDNLKPPPGVVLPPREIRNVLEKTAGYVVRNGIVFEDRVRDKESTNPKFSFVNPSDAYYPFY
QWRLSEIKAGRGTEIASGRPGEGQMSAPEKPKGPTAPPEFQFSAKMPRINQKDLDVLKLTAQFTARFGRQWMAQL
HQRETGNPQFQFLASNHTFHNFFQHMVDQYSNVFKYHENPQLSRELLSESREMIKNPYIVYNRAVHRAEYAKHQE
TEKQKKEQHEEQKKQEFARIDWSDFIVVETVTFSDADETANLPGPTSLSELQYASLEDRNKASIGASMRIEEAMP
GEDMEPPPLAQMPAAGQQTSHALPARPGSAQHPPPPPVGAHPQLGQVSGPEAPPAHPPMTQEEEERQRIQERAEA
QARMHQAQAEARGGTAPMKIKENYVPRAAQRAATKQEPQMALCPNCKQLIAVNELESHMRIELLDPKWKEQKAKA
ESRYAHSNISHADVANNLKRLASQRSDVFDPMTGQAVSEDELARRKKAAMNSFDGNPEGKSQAHMNHLQTFNVEE
QIRAIHQKFADQKSADKK*
Coding >Hirsu2|1593
ATGGCAGCTTCTGCGGCCAACGGCGAGGCCTCCTCCGTCCTCGACAACCTCAAGCCGCCGCCCGGAGTCGTCCTC
CCGCCCCGCGAGATCCGCAACGTGCTGGAGAAGACGGCAGGCTACGTGGTGCGAAACGGCATCGTCTTCGAGGAT
CGCGTCCGCGACAAGGAGAGCACAAACCCAAAGTTCAGCTTCGTCAACCCCTCCGATGCCTACTACCCCTTCTAC
CAATGGCGCCTGAGCGAGATCAAGGCCGGCCGCGGTACCGAAATCGCCAGCGGCCGCCCTGGCGAAGGCCAAATG
TCGGCGCCAGAGAAGCCCAAGGGGCCGACCGCCCCGCCCGAGTTCCAGTTCTCGGCCAAGATGCCGCGCATCAAC
CAGAAGGACCTCGACGTTCTCAAGCTGACGGCGCAGTTTACCGCCAGGTTTGGGCGCCAGTGGATGGCGCAGCTG
CACCAGCGTGAGACGGGCAACCCGCAGTTCCAGTTTTTGGCATCCAACCACACCTTCCACAACTTCTTCCAGCAC
ATGGTCGACCAGTACTCCAATGTCTTCAAGTATCACGAGAACCCGCAGCTCAGTCGGGAGCTCCTCTCCGAATCC
CGAGAGATGATCAAGAACCCGTACATTGTTTACAACCGAGCCGTACACCGAGCCGAGTACGCCAAGCACCAGGAG
ACGGAGAAGCAGAAGAAGGAGCAGCACGAGGAGCAGAAGAAGCAGGAGTTTGCTCGTATCGACTGGAGCGACTTC
ATCGTCGTCGAGACCGTCACCTTCTCCGACGCCGACGAGACGGCCAACCTGCCGGGCCCGACGAGCCTCTCCGAG
CTGCAGTACGCCTCCCTGGAGGACAGAAACAAGGCGTCCATCGGCGCCAGCATGCGGATCGAGGAGGCCATGCCC
GGCGAAGACATGGAACCGCCGCCGCTCGCCCAGATGCCAGCCGCCGGCCAGCAGACAAGCCATGCTCTGCCCGCT
CGACCCGGCTCTGCGCAGCATCCGCCGCCGCCGCCAGTGGGCGCACATCCCCAACTCGGACAGGTGTCCGGGCCG
GAGGCTCCGCCGGCCCATCCGCCCATGACGCAGGAGGAGGAGGAGAGGCAGCGTATCCAGGAGAGAGCCGAGGCG
CAGGCTCGCATGCACCAGGCCCAAGCCGAGGCCCGAGGGGGGACCGCGCCCATGAAGATCAAGGAAAACTACGTG
CCTCGGGCCGCGCAGCGTGCGGCAACGAAGCAGGAACCGCAGATGGCCTTGTGCCCCAACTGCAAGCAGCTGATA
GCGGTGAACGAGCTGGAGTCTCACATGCGAATCGAACTTTTGGATCCGAAATGGAAGGAACAGAAAGCCAAGGCC
GAGTCTCGGTACGCGCACTCCAACATCTCGCACGCGGACGTGGCGAACAACCTTAAGAGGCTTGCGAGCCAGCGG
AGCGACGTTTTCGACCCGATGACGGGCCAGGCGGTCAGCGAGGACGAGCTCGCGCGGCGCAAGAAGGCGGCCATG
AACAGCTTCGATGGCAACCCCGAGGGCAAGAGCCAGGCGCACATGAACCACCTGCAGACGTTCAACGTGGAGGAG
CAGATCCGGGCCATCCACCAGAAGTTTGCCGATCAGAAGTCGGCCGACAAGAAGTGA
Transcript >Hirsu2|1593
ATGGCAGCTTCTGCGGCCAACGGCGAGGCCTCCTCCGTCCTCGACAACCTCAAGCCGCCGCCCGGAGTCGTCCTC
CCGCCCCGCGAGATCCGCAACGTGCTGGAGAAGACGGCAGGCTACGTGGTGCGAAACGGCATCGTCTTCGAGGAT
CGCGTCCGCGACAAGGAGAGCACAAACCCAAAGTTCAGCTTCGTCAACCCCTCCGATGCCTACTACCCCTTCTAC
CAATGGCGCCTGAGCGAGATCAAGGCCGGCCGCGGTACCGAAATCGCCAGCGGCCGCCCTGGCGAAGGCCAAATG
TCGGCGCCAGAGAAGCCCAAGGGGCCGACCGCCCCGCCCGAGTTCCAGTTCTCGGCCAAGATGCCGCGCATCAAC
CAGAAGGACCTCGACGTTCTCAAGCTGACGGCGCAGTTTACCGCCAGGTTTGGGCGCCAGTGGATGGCGCAGCTG
CACCAGCGTGAGACGGGCAACCCGCAGTTCCAGTTTTTGGCATCCAACCACACCTTCCACAACTTCTTCCAGCAC
ATGGTCGACCAGTACTCCAATGTCTTCAAGTATCACGAGAACCCGCAGCTCAGTCGGGAGCTCCTCTCCGAATCC
CGAGAGATGATCAAGAACCCGTACATTGTTTACAACCGAGCCGTACACCGAGCCGAGTACGCCAAGCACCAGGAG
ACGGAGAAGCAGAAGAAGGAGCAGCACGAGGAGCAGAAGAAGCAGGAGTTTGCTCGTATCGACTGGAGCGACTTC
ATCGTCGTCGAGACCGTCACCTTCTCCGACGCCGACGAGACGGCCAACCTGCCGGGCCCGACGAGCCTCTCCGAG
CTGCAGTACGCCTCCCTGGAGGACAGAAACAAGGCGTCCATCGGCGCCAGCATGCGGATCGAGGAGGCCATGCCC
GGCGAAGACATGGAACCGCCGCCGCTCGCCCAGATGCCAGCCGCCGGCCAGCAGACAAGCCATGCTCTGCCCGCT
CGACCCGGCTCTGCGCAGCATCCGCCGCCGCCGCCAGTGGGCGCACATCCCCAACTCGGACAGGTGTCCGGGCCG
GAGGCTCCGCCGGCCCATCCGCCCATGACGCAGGAGGAGGAGGAGAGGCAGCGTATCCAGGAGAGAGCCGAGGCG
CAGGCTCGCATGCACCAGGCCCAAGCCGAGGCCCGAGGGGGGACCGCGCCCATGAAGATCAAGGAAAACTACGTG
CCTCGGGCCGCGCAGCGTGCGGCAACGAAGCAGGAACCGCAGATGGCCTTGTGCCCCAACTGCAAGCAGCTGATA
GCGGTGAACGAGCTGGAGTCTCACATGCGAATCGAACTTTTGGATCCGAAATGGAAGGAACAGAAAGCCAAGGCC
GAGTCTCGGTACGCGCACTCCAACATCTCGCACGCGGACGTGGCGAACAACCTTAAGAGGCTTGCGAGCCAGCGG
AGCGACGTTTTCGACCCGATGACGGGCCAGGCGGTCAGCGAGGACGAGCTCGCGCGGCGCAAGAAGGCGGCCATG
AACAGCTTCGATGGCAACCCCGAGGGCAAGAGCCAGGCGCACATGAACCACCTGCAGACGTTCAACGTGGAGGAG
CAGATCCGGGCCATCCACCAGAAGTTTGCCGATCAGAAGTCGGCCGACAAGAAGTGA
Gene >Hirsu2|1593
ATGGCAGCTTCTGCGGCCAACGGCGAGGCCTCCTCCGTCCTCGACAACCTCAAGCCGCCGCCCGGAGTCGTCCTC
CCGCCCCGCGAGATCCGCAACGTGCTGGAGAAGACGGCAGGCTACGTGGTGCGAAACGGCATCGTCTTCGAGGAT
CGCGTCCGCGACAAGGAGAGCACAAACCCAAAGTTCAGCTTCGTCAACCCCTCCGATGCCTACTACCCCTTCTAC
CAATGGCGCCTGAGCGAGATCAAGGCCGGCCGCGGTACCGAAATCGCCAGCGGCCGCCCTGGCGAAGGCCAAATG
TCGGCGCCAGAGAAGCCCAAGGGGCCGACCGCCCCGCCCGAGTTCCAGTTCTCGGCCAAGATGCCGCGCATCAAC
CAGAAGGACCTCGACGTTCTCAAGCTGACGGCGCAGTTTACCGCCAGGTTTGGGCGCCAGTGGATGGCGCAGCTG
CACCAGCGTGAGACGGGCAACCCGCAGTTCCAGTTTTTGGCATCCAACCACACCTTCCACAACTTCTTCCAGCAC
ATGGTCGACCAGTACTCCAATGTCTTCAAGTATCACGAGAACCCGCAGCTCAGTCGGGAGCTCCTCTCCGAATCC
CGAGAGATGATCAAGAACCCGTACATTGTTTACAACCGAGCCGTACACCGAGCCGAGTACGCCAAGCACCAGGAG
ACGGAGAAGCAGAAGAAGGAGCAGCACGAGGAGCAGAAGAAGCAGGAGTTTGCTCGTATCGACTGGAGCGACTTC
ATCGTCGTCGAGACCGTCACCTTCTCCGACGCCGACGAGACGGCCAACCTGCCGGGCCCGACGAGCCTCTCCGAG
CTGCAGTACGCCTCCCTGGAGGACAGAAACAAGGCGTCCATCGGCGCCAGCATGCGGATCGAGGAGGCCATGCCC
GGCGAAGACATGGAACCGCCGCCGCTCGCCCAGATGCCAGCCGCCGGCCAGCAGACAAGCCATGCTCTGCCCGCT
CGACCCGGCTCTGCGCAGCATCCGCCGCCGCCGCCAGTGGGCGCACATCCCCAACTCGGACAGGTGTCCGGGCCG
GAGGCTCCGCCGGCCCATCCGCCCATGACGCAGGAGGAGGAGGAGAGGCAGCGTATCCAGGAGAGAGCCGAGGCG
CAGGCTCGCATGCACCAGGCCCAAGCCGAGGCCCGAGGGGGGACCGCGCCCATGAAGATCAAGGAAAACTACGTG
CCTCGGGCCGCGCAGCGTGCGGCAACGAAGCAGGAACCGCAGATGGCCTTGTGCCCCAACTGCAAGCAGCTGATA
GCGGTGAACGAGCTGGAGTCTCACATGCGAAGTAAGTCATGGTATGGGCCGGACGTGGCTGGAAGCGTTGTGCTG
ACCGATGTTTGCACCCAGTCGAACTTTTGGATCCGAAATGGAAGGAACAGAAAGCCAAGGCCGAGTCTCGGTACG
CGCACTCCAACATCTCGCACGCGGACGTGGCGAACAACCTTAAGAGGCTTGCGAGCCAGCGGAGCGACGTTTTCG
ACCCGATGACGGGCCAGGCGGTCAGCGAGGACGAGCTCGCGCGGCGCAAGAAGGCGGCCATGAACAGCTTCGATG
GCAACCCCGAGGGCAAGAGCCAGGCGCACATGAACCACCTGCAGACGTTCAACGTGGAGGAGCAGATCCGGGCCA
TCCACCAGAAGTTTGCCGATCAGAAGTCGGCCGACAAGAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail