Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1587
Gene name
LocationContig_1353:5748..7032
Strand-
Gene length (bp)1284
Transcript length (bp)1284
Coding sequence length (bp)1284
Protein length (aa) 428

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04757 Pex2_Pex12 Pex2 / Pex12 amino terminal region 2.6E-50 25 278

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C8VCP8|PEX12_EMENI Peroxisome assembly protein 12 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=PEX12 PE=3 SV=1 1 427 6.0E-157
sp|Q01961|PEX12_PICPA Peroxisome assembly protein 12 OS=Komagataella pastoris GN=PEX12 PE=3 SV=1 1 427 2.0E-44
sp|O00623|PEX12_HUMAN Peroxisome assembly protein 12 OS=Homo sapiens GN=PEX12 PE=1 SV=1 13 383 6.0E-31
sp|Q9ET67|PEX12_CRILO Peroxisome assembly protein 12 OS=Cricetulus longicaudatus GN=PEX12 PE=2 SV=1 13 383 1.0E-30
sp|Q8VC48|PEX12_MOUSE Peroxisome assembly protein 12 OS=Mus musculus GN=Pex12 PE=1 SV=1 13 279 6.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C8VCP8|PEX12_EMENI Peroxisome assembly protein 12 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=PEX12 PE=3 SV=1 1 427 6.0E-157
sp|Q01961|PEX12_PICPA Peroxisome assembly protein 12 OS=Komagataella pastoris GN=PEX12 PE=3 SV=1 1 427 2.0E-44
sp|O00623|PEX12_HUMAN Peroxisome assembly protein 12 OS=Homo sapiens GN=PEX12 PE=1 SV=1 13 383 6.0E-31
sp|Q9ET67|PEX12_CRILO Peroxisome assembly protein 12 OS=Cricetulus longicaudatus GN=PEX12 PE=2 SV=1 13 383 1.0E-30
sp|Q8VC48|PEX12_MOUSE Peroxisome assembly protein 12 OS=Mus musculus GN=Pex12 PE=1 SV=1 13 279 6.0E-30
sp|A4FUD4|PEX12_BOVIN Peroxisome assembly protein 12 OS=Bos taurus GN=PEX12 PE=2 SV=1 13 383 2.0E-29
sp|O88177|PEX12_RAT Peroxisome assembly protein 12 OS=Rattus norvegicus GN=Pex12 PE=2 SV=1 13 383 4.0E-28
sp|Q54N40|PEX12_DICDI Putative peroxisome assembly protein 12 OS=Dictyostelium discoideum GN=pex12 PE=3 SV=1 3 384 2.0E-23
sp|Q19189|PEX12_CAEEL Putative peroxisome assembly protein 12 OS=Caenorhabditis elegans GN=prx-12 PE=3 SV=1 12 384 2.0E-21
sp|Q04370|PEX12_YEAST Peroxisome assembly protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX12 PE=1 SV=1 16 427 4.0E-21
sp|Q9M841|PEX12_ARATH Peroxisome biogenesis protein 12 OS=Arabidopsis thaliana GN=PEX12 PE=1 SV=2 12 383 1.0E-18
sp|Q8TFH8|PEX12_SCHPO Peroxisome assembly protein 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex12 PE=3 SV=2 14 388 2.0E-18
sp|Q9VPT5|PEX12_DROME Peroxisome assembly protein 12 OS=Drosophila melanogaster GN=Pex12 PE=2 SV=1 13 379 2.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

Domain # Start End Length
1 176 198 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1587
MEFVAALRGTFDDNKPSLFEVLSEQQLNGLLPPTLRYLLTVATQRHPRYLLRILNSFDELYALSMLLVERHYLRT
RAGSFTENFYGLKRERALEGEIPRASLAAPRLVREALGLTTADVWRNLAVLVGLPYVKRKLDEDYEVNAPRALLG
AAYTRMPENPSLRQRFLHYYRYFLRHVYPTVNAAYYFALLAFNLGYLFDRTKYHNPFMWLIGTRLRRMTRADHLA
IESLAKTSNAAARPGPRSILSPSQLGAKAMSSLSLLLPVSIFALKFLEWWYQSDFAKQLSRKAGEHVDLPPPVLS
SPRSKCAPGRGTSEKGKEPAEGGSPAEITAEDAPIATPSMLPVYVVRTPQDTSACPICQDDIVTPTACQTGVVYC
YSCIHKWIEGSHPRQESFMENRAGQWESGQGRCAVTGKRILGGTEGLRRIMV*
Coding >Hirsu2|1587
ATGGAATTCGTCGCGGCCCTCCGGGGCACCTTCGACGACAACAAGCCGTCCCTGTTCGAGGTCCTCTCCGAGCAG
CAGCTCAACGGGCTCCTCCCCCCGACGCTCCGCTACCTCCTCACCGTCGCCACCCAGCGCCACCCGAGATACCTG
CTGCGGATCCTCAACTCGTTCGACGAGCTGTACGCCCTGTCCATGCTGCTGGTCGAGCGCCACTACCTCCGCACC
CGCGCCGGCTCCTTCACCGAGAACTTCTACGGGCTCAAGCGCGAGAGGGCCCTCGAGGGCGAGATCCCGCGCGCC
AGCCTCGCCGCCCCGCGCCTGGTGCGCGAGGCCCTCGGGCTGACGACGGCCGACGTCTGGAGGAACCTCGCCGTG
CTCGTCGGCCTGCCCTACGTCAAGAGGAAGCTGGACGAGGACTACGAGGTCAACGCGCCGCGCGCCCTGCTCGGC
GCCGCCTACACGCGCATGCCCGAGAATCCGTCGCTGCGCCAGCGCTTCCTGCACTACTATCGCTACTTCCTGCGC
CACGTCTACCCGACCGTCAACGCCGCCTACTACTTCGCCCTGCTGGCCTTCAACCTCGGCTACCTCTTCGACCGC
ACCAAGTACCACAACCCGTTCATGTGGCTCATCGGCACCAGGCTGCGCAGGATGACCCGGGCTGACCATCTGGCC
ATCGAGTCCCTGGCCAAGACATCCAACGCCGCCGCGCGACCCGGTCCGCGCTCCATCCTGTCGCCCAGCCAGCTG
GGCGCCAAGGCCATGTCCAGCCTCTCCCTGCTCCTCCCCGTCAGCATCTTCGCCCTCAAGTTCCTGGAGTGGTGG
TACCAGTCCGATTTCGCCAAGCAGCTCTCCCGCAAGGCTGGCGAGCACGTCGATCTCCCGCCACCCGTCCTGTCA
AGCCCCAGGAGCAAATGCGCGCCCGGGAGGGGGACGAGCGAGAAGGGAAAGGAGCCGGCCGAGGGAGGCAGCCCG
GCCGAGATCACGGCCGAGGATGCCCCGATCGCGACTCCCTCCATGCTGCCCGTCTACGTCGTCCGGACGCCCCAA
GACACCTCGGCGTGCCCCATCTGCCAGGACGACATTGTCACGCCCACGGCCTGCCAGACCGGCGTCGTCTACTGC
TACTCCTGCATCCACAAGTGGATCGAGGGCTCACACCCCAGGCAGGAGAGTTTCATGGAGAACCGCGCCGGGCAA
TGGGAGAGCGGCCAGGGCCGATGCGCCGTCACTGGGAAACGCATTCTTGGCGGAACCGAGGGCCTGCGGCGCATC
ATGGTATAG
Transcript >Hirsu2|1587
ATGGAATTCGTCGCGGCCCTCCGGGGCACCTTCGACGACAACAAGCCGTCCCTGTTCGAGGTCCTCTCCGAGCAG
CAGCTCAACGGGCTCCTCCCCCCGACGCTCCGCTACCTCCTCACCGTCGCCACCCAGCGCCACCCGAGATACCTG
CTGCGGATCCTCAACTCGTTCGACGAGCTGTACGCCCTGTCCATGCTGCTGGTCGAGCGCCACTACCTCCGCACC
CGCGCCGGCTCCTTCACCGAGAACTTCTACGGGCTCAAGCGCGAGAGGGCCCTCGAGGGCGAGATCCCGCGCGCC
AGCCTCGCCGCCCCGCGCCTGGTGCGCGAGGCCCTCGGGCTGACGACGGCCGACGTCTGGAGGAACCTCGCCGTG
CTCGTCGGCCTGCCCTACGTCAAGAGGAAGCTGGACGAGGACTACGAGGTCAACGCGCCGCGCGCCCTGCTCGGC
GCCGCCTACACGCGCATGCCCGAGAATCCGTCGCTGCGCCAGCGCTTCCTGCACTACTATCGCTACTTCCTGCGC
CACGTCTACCCGACCGTCAACGCCGCCTACTACTTCGCCCTGCTGGCCTTCAACCTCGGCTACCTCTTCGACCGC
ACCAAGTACCACAACCCGTTCATGTGGCTCATCGGCACCAGGCTGCGCAGGATGACCCGGGCTGACCATCTGGCC
ATCGAGTCCCTGGCCAAGACATCCAACGCCGCCGCGCGACCCGGTCCGCGCTCCATCCTGTCGCCCAGCCAGCTG
GGCGCCAAGGCCATGTCCAGCCTCTCCCTGCTCCTCCCCGTCAGCATCTTCGCCCTCAAGTTCCTGGAGTGGTGG
TACCAGTCCGATTTCGCCAAGCAGCTCTCCCGCAAGGCTGGCGAGCACGTCGATCTCCCGCCACCCGTCCTGTCA
AGCCCCAGGAGCAAATGCGCGCCCGGGAGGGGGACGAGCGAGAAGGGAAAGGAGCCGGCCGAGGGAGGCAGCCCG
GCCGAGATCACGGCCGAGGATGCCCCGATCGCGACTCCCTCCATGCTGCCCGTCTACGTCGTCCGGACGCCCCAA
GACACCTCGGCGTGCCCCATCTGCCAGGACGACATTGTCACGCCCACGGCCTGCCAGACCGGCGTCGTCTACTGC
TACTCCTGCATCCACAAGTGGATCGAGGGCTCACACCCCAGGCAGGAGAGTTTCATGGAGAACCGCGCCGGGCAA
TGGGAGAGCGGCCAGGGCCGATGCGCCGTCACTGGGAAACGCATTCTTGGCGGAACCGAGGGCCTGCGGCGCATC
ATGGTATAG
Gene >Hirsu2|1587
ATGGAATTCGTCGCGGCCCTCCGGGGCACCTTCGACGACAACAAGCCGTCCCTGTTCGAGGTCCTCTCCGAGCAG
CAGCTCAACGGGCTCCTCCCCCCGACGCTCCGCTACCTCCTCACCGTCGCCACCCAGCGCCACCCGAGATACCTG
CTGCGGATCCTCAACTCGTTCGACGAGCTGTACGCCCTGTCCATGCTGCTGGTCGAGCGCCACTACCTCCGCACC
CGCGCCGGCTCCTTCACCGAGAACTTCTACGGGCTCAAGCGCGAGAGGGCCCTCGAGGGCGAGATCCCGCGCGCC
AGCCTCGCCGCCCCGCGCCTGGTGCGCGAGGCCCTCGGGCTGACGACGGCCGACGTCTGGAGGAACCTCGCCGTG
CTCGTCGGCCTGCCCTACGTCAAGAGGAAGCTGGACGAGGACTACGAGGTCAACGCGCCGCGCGCCCTGCTCGGC
GCCGCCTACACGCGCATGCCCGAGAATCCGTCGCTGCGCCAGCGCTTCCTGCACTACTATCGCTACTTCCTGCGC
CACGTCTACCCGACCGTCAACGCCGCCTACTACTTCGCCCTGCTGGCCTTCAACCTCGGCTACCTCTTCGACCGC
ACCAAGTACCACAACCCGTTCATGTGGCTCATCGGCACCAGGCTGCGCAGGATGACCCGGGCTGACCATCTGGCC
ATCGAGTCCCTGGCCAAGACATCCAACGCCGCCGCGCGACCCGGTCCGCGCTCCATCCTGTCGCCCAGCCAGCTG
GGCGCCAAGGCCATGTCCAGCCTCTCCCTGCTCCTCCCCGTCAGCATCTTCGCCCTCAAGTTCCTGGAGTGGTGG
TACCAGTCCGATTTCGCCAAGCAGCTCTCCCGCAAGGCTGGCGAGCACGTCGATCTCCCGCCACCCGTCCTGTCA
AGCCCCAGGAGCAAATGCGCGCCCGGGAGGGGGACGAGCGAGAAGGGAAAGGAGCCGGCCGAGGGAGGCAGCCCG
GCCGAGATCACGGCCGAGGATGCCCCGATCGCGACTCCCTCCATGCTGCCCGTCTACGTCGTCCGGACGCCCCAA
GACACCTCGGCGTGCCCCATCTGCCAGGACGACATTGTCACGCCCACGGCCTGCCAGACCGGCGTCGTCTACTGC
TACTCCTGCATCCACAAGTGGATCGAGGGCTCACACCCCAGGCAGGAGAGTTTCATGGAGAACCGCGCCGGGCAA
TGGGAGAGCGGCCAGGGCCGATGCGCCGTCACTGGGAAACGCATTCTTGGCGGAACCGAGGGCCTGCGGCGCATC
ATGGTATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail