Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1583
Gene name
LocationContig_1352:1154..1840
Strand+
Gene length (bp)686
Transcript length (bp)549
Coding sequence length (bp)549
Protein length (aa) 183

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00227 Proteasome Proteasome subunit 7.7E-32 3 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6U7|PSB4_NEUCR Probable proteasome subunit beta type-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pcb-4 PE=3 SV=2 1 182 4.0E-115
sp|A5DB52|PSB4_PICGU Probable proteasome subunit beta type-4 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PRO2 PE=3 SV=1 2 172 2.0E-72
sp|P22141|PSB4_YEAST Proteasome subunit beta type-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE1 PE=1 SV=2 2 172 3.0E-71
sp|Q09720|PSB4_SCHPO Probable proteasome subunit beta type-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC31A2.04c PE=3 SV=1 1 171 9.0E-67
sp|P0CQ12|PSB4_CRYNJ Probable proteasome subunit beta type-4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CPR1 PE=3 SV=1 2 155 5.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6U7|PSB4_NEUCR Probable proteasome subunit beta type-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pcb-4 PE=3 SV=2 1 182 4.0E-115
sp|A5DB52|PSB4_PICGU Probable proteasome subunit beta type-4 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PRO2 PE=3 SV=1 2 172 2.0E-72
sp|P22141|PSB4_YEAST Proteasome subunit beta type-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE1 PE=1 SV=2 2 172 3.0E-71
sp|Q09720|PSB4_SCHPO Probable proteasome subunit beta type-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC31A2.04c PE=3 SV=1 1 171 9.0E-67
sp|P0CQ12|PSB4_CRYNJ Probable proteasome subunit beta type-4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CPR1 PE=3 SV=1 2 155 5.0E-47
sp|P0CQ13|PSB4_CRYNB Probable proteasome subunit beta type-4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CPR1 PE=3 SV=1 2 155 5.0E-47
sp|P40307|PSB2_RAT Proteasome subunit beta type-2 OS=Rattus norvegicus GN=Psmb2 PE=1 SV=1 7 172 5.0E-44
sp|Q9R1P3|PSB2_MOUSE Proteasome subunit beta type-2 OS=Mus musculus GN=Psmb2 PE=1 SV=1 7 172 8.0E-44
sp|P49721|PSB2_HUMAN Proteasome subunit beta type-2 OS=Homo sapiens GN=PSMB2 PE=1 SV=1 7 172 5.0E-43
sp|Q5E9K0|PSB2_BOVIN Proteasome subunit beta type-2 OS=Bos taurus GN=PSMB2 PE=1 SV=1 7 172 9.0E-43
sp|Q55DY7|PSB2_DICDI Proteasome subunit beta type-2 OS=Dictyostelium discoideum GN=psmB2 PE=3 SV=1 7 174 2.0E-42
sp|O23714|PSB2A_ARATH Proteasome subunit beta type-2-A OS=Arabidopsis thaliana GN=PBD1 PE=1 SV=1 8 170 2.0E-41
sp|O24633|PSB2B_ARATH Proteasome subunit beta type-2-B OS=Arabidopsis thaliana GN=PBD2 PE=1 SV=1 8 167 2.0E-41
sp|Q9LST6|PSB2_ORYSJ Proteasome subunit beta type-2 OS=Oryza sativa subsp. japonica GN=PBD1 PE=2 SV=2 8 167 1.0E-40
sp|P91477|PSB2_CAEEL Proteasome subunit beta type-2 OS=Caenorhabditis elegans GN=pbs-4 PE=3 SV=2 3 167 1.0E-33
sp|Q9NHC6|PSB2_TRYBB Proteasome subunit beta type-2 OS=Trypanosoma brucei brucei GN=PSB4 PE=2 SV=1 10 172 1.0E-28
sp|Q8SRF1|PSB4_ENCCU Probable proteasome subunit beta type-4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PRE1 PE=1 SV=1 6 169 4.0E-25
sp|Q9VQE5|PSB2_DROME Probable proteasome subunit beta type-2 OS=Drosophila melanogaster GN=Prosbeta4R2 PE=2 SV=3 1 172 9.0E-25
sp|A5UM14|PSB_METS3 Proteasome subunit beta OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=psmB PE=3 SV=1 12 180 2.0E-13
sp|C6A2V9|PSB1_THESM Proteasome subunit beta 1 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB1 PE=3 SV=1 3 167 3.0E-12
sp|Q9V0N9|PSB2_PYRAB Proteasome subunit beta 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB2 PE=3 SV=1 13 167 6.0E-12
sp|O50110|PSB2_PYRHO Proteasome subunit beta 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB2 PE=3 SV=1 13 167 8.0E-12
sp|Q8U125|PSB2_PYRFU Proteasome subunit beta 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB2 PE=3 SV=1 3 167 1.0E-11
sp|C5A7L1|PSB1_THEGJ Proteasome subunit beta 1 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB1 PE=3 SV=1 13 172 3.0E-10
sp|A2BN27|PSB2_HYPBU Proteasome subunit beta 2 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB2 PE=3 SV=1 26 181 6.0E-09
sp|Q4JAA8|PSB2_SULAC Proteasome subunit beta 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB2 PE=3 SV=1 47 173 1.0E-08
sp|Q46G14|PSB_METBF Proteasome subunit beta OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=psmB PE=3 SV=1 23 150 3.0E-08
sp|Q9YER0|PSB2_AERPE Proteasome subunit beta 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB2 PE=3 SV=2 13 144 3.0E-08
sp|A1RWY6|PSB1_THEPD Proteasome subunit beta 1 OS=Thermofilum pendens (strain Hrk 5) GN=psmB1 PE=3 SV=1 17 168 4.0E-08
sp|Q5JDJ9|PSB1_THEKO Proteasome subunit beta 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB1 PE=3 SV=1 3 167 6.0E-08
sp|B1YDJ0|PSB2_PYRNV Proteasome subunit beta 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB2 PE=3 SV=1 7 167 7.0E-08
sp|Q8TW10|PSB_METKA Proteasome subunit beta OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmB PE=3 SV=1 26 152 8.0E-08
sp|Q9YES4|PSB1_AERPE Proteasome subunit beta 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB1 PE=3 SV=2 3 133 9.0E-08
sp|Q8ZST5|PSB2_PYRAE Proteasome subunit beta 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB2 PE=3 SV=1 7 158 2.0E-07
sp|Q975D1|PSB2_SULTO Proteasome subunit beta 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB2 PE=3 SV=1 76 177 2.0E-07
sp|A4YIE0|PSB1_METS5 Proteasome subunit beta 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB1 PE=3 SV=1 76 177 2.0E-07
sp|Q8TJB5|PSB_METAC Proteasome subunit beta OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=psmB PE=3 SV=1 23 150 3.0E-07
sp|Q9P992|PSB_METTE Proteasome subunit beta OS=Methanosarcina thermophila GN=psmB PE=3 SV=1 23 150 4.0E-07
sp|Q8PZ04|PSB_METMA Proteasome subunit beta OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=psmB PE=3 SV=1 23 150 4.0E-07
sp|A1RSJ8|PSB1_PYRIL Proteasome subunit beta 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB1 PE=3 SV=1 7 158 5.0E-07
sp|A3MXQ6|PSB2_PYRCJ Proteasome subunit beta 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB2 PE=3 SV=1 7 167 6.0E-07
sp|D5EAS6|PSB_METMS Proteasome subunit beta OS=Methanohalophilus mahii (strain ATCC 35705 / DSM 5219 / SLP) GN=psmB PE=3 SV=1 23 172 7.0E-07
sp|Q6L181|PSB_PICTO Proteasome subunit beta OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=psmB PE=3 SV=1 13 150 1.0E-06
sp|C9REN7|PSB_METVM Proteasome subunit beta OS=Methanocaldococcus vulcanius (strain ATCC 700851 / DSM 12094 / M7) GN=psmB PE=3 SV=1 17 168 2.0E-06
sp|A8AB58|PSB2_IGNH4 Proteasome subunit beta 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB2 PE=3 SV=1 3 168 3.0E-06
sp|D3E0A3|PSB_METRM Proteasome subunit beta OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=psmB PE=3 SV=1 12 167 3.0E-06
sp|C3NHF1|PSB2_SULIN Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB2 PE=3 SV=1 26 173 3.0E-06
sp|A3DN21|PSB1_STAMF Proteasome subunit beta 1 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB1 PE=3 SV=1 6 167 4.0E-06
sp|Q9UXF3|PSB2_SULSO Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB2 PE=3 SV=2 26 173 7.0E-06
sp|A6UT20|PSB_META3 Proteasome subunit beta OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=psmB PE=3 SV=1 13 168 8.0E-06
sp|D0KTH0|PSB2_SULS9 Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB2 PE=3 SV=2 26 173 8.0E-06
sp|Q58634|PSB_METJA Proteasome subunit beta OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=psmB PE=1 SV=1 17 180 8.0E-06
sp|A4YJ04|PSB2_METS5 Proteasome subunit beta 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB2 PE=3 SV=1 3 173 8.0E-06
sp|C3NE98|PSB1_SULIY Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB1 PE=3 SV=1 26 173 8.0E-06
sp|C3MVD5|PSB1_SULIM Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB1 PE=3 SV=1 26 173 8.0E-06
sp|C3MQ16|PSB1_SULIL Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB1 PE=3 SV=1 26 173 8.0E-06
sp|C4KHB0|PSB1_SULIK Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB1 PE=3 SV=1 26 173 8.0E-06
sp|D2PK63|PSB1_SULID Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB1 PE=3 SV=1 26 173 8.0E-06
sp|C3N5N4|PSB1_SULIA Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB1 PE=3 SV=1 26 173 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005839 proteasome core complex Yes
GO:0051603 proteolysis involved in cellular protein catabolic process Yes
GO:0004298 threonine-type endopeptidase activity Yes
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0005575 cellular_component No
GO:0006508 proteolysis No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0004175 endopeptidase activity No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0070003 threonine-type peptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0008233 peptidase activity No
GO:0044464 cell part No
GO:0019538 protein metabolic process No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0044424 intracellular part No
GO:0032991 protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1583
MRGATILKASDDKTRALNKHTLLAFSGEAGDTVQFAEYIQRNAQLYSMRNETELSPSGLAHFVRGELASSLRSRH
PYNVNLLMGGVDPISGKPSLYWIDYLASMAELPYAAHGYAQYYCLSILDKHHHPDITLGQGIKILNMCIDELKRR
LPIDFKGMVVKAIKVDGIVDIEFDDDRVVKSA*
Coding >Hirsu2|1583
ATGCGAGGCGCCACCATCCTCAAGGCGTCCGACGACAAGACGAGGGCGCTGAACAAGCACACGCTGCTGGCCTTC
TCCGGCGAGGCGGGGGATACAGTCCAATTCGCCGAGTACATCCAAAGAAACGCCCAGCTTTATTCGATGCGCAAC
GAGACGGAGCTCTCTCCGTCGGGGCTGGCTCACTTCGTGCGAGGCGAGCTGGCCTCGAGCTTGCGCTCCCGACAC
CCCTACAACGTGAACCTGCTGATGGGCGGCGTGGATCCCATCTCGGGCAAGCCGTCGCTCTACTGGATCGACTAC
CTGGCGTCGATGGCCGAGTTGCCGTACGCGGCTCACGGATACGCGCAGTACTACTGCCTGTCCATCCTGGACAAG
CATCACCATCCCGACATCACACTCGGCCAGGGCATCAAGATCCTGAACATGTGCATCGACGAGCTGAAGAGGCGG
TTACCCATCGACTTCAAGGGCATGGTGGTCAAGGCGATCAAGGTGGACGGCATCGTGGACATAGAGTTTGACGAC
GACCGCGTGGTCAAGAGCGCCTGA
Transcript >Hirsu2|1583
ATGCGAGGCGCCACCATCCTCAAGGCGTCCGACGACAAGACGAGGGCGCTGAACAAGCACACGCTGCTGGCCTTC
TCCGGCGAGGCGGGGGATACAGTCCAATTCGCCGAGTACATCCAAAGAAACGCCCAGCTTTATTCGATGCGCAAC
GAGACGGAGCTCTCTCCGTCGGGGCTGGCTCACTTCGTGCGAGGCGAGCTGGCCTCGAGCTTGCGCTCCCGACAC
CCCTACAACGTGAACCTGCTGATGGGCGGCGTGGATCCCATCTCGGGCAAGCCGTCGCTCTACTGGATCGACTAC
CTGGCGTCGATGGCCGAGTTGCCGTACGCGGCTCACGGATACGCGCAGTACTACTGCCTGTCCATCCTGGACAAG
CATCACCATCCCGACATCACACTCGGCCAGGGCATCAAGATCCTGAACATGTGCATCGACGAGCTGAAGAGGCGG
TTACCCATCGACTTCAAGGGCATGGTGGTCAAGGCGATCAAGGTGGACGGCATCGTGGACATAGAGTTTGACGAC
GACCGCGTGGTCAAGAGCGCCTGA
Gene >Hirsu2|1583
ATGCGAGGCGCCACCATCCTCAAGGCGTCCGACGACAAGACGAGGGCGCTGAACAAGCACACGCTGCTGGCCTTC
TCCGGCGAGGCGGGGGATACAGGTACGGCCTCGTCCTCTCCCCCGGTTGACGGGCGTCGGGGCACGCAGGGCTCG
GTCTGACGCGCGGCCGCAGTCCAATTCGCCGAGTACATCCAAAGAAACGCCCAGCTTTATTCGATGCGCAACGAG
ACGGAGCTCTCTCCGTCGGGGCTGGCTCACTTCGTGCGAGGCGAGCTGGCCTCGAGCTTGCGCTCCCGACACCCC
TACAACGTGAACCTGCTGATGGGCGGCGTGGATCCCATCTCGGGCAAGCCGTCGCTCTACTGGATCGACTACCTG
GCGTCGATGGCCGAGTTGCCGTACGCGGCTCACGGATACGCGCAGTAGGTCCTGCCCGCGCCATGATGATGCTTC
CAGCTGCTGAGCTCATGTGTTTCTTTTTCGACAGGTACTACTGCCTGTCCATCCTGGACAAGCATCACCATCCCG
ACATCACACTCGGCCAGGGCATCAAGATCCTGAACATGTGCATCGACGAGCTGAAGAGGCGGTTACCCATCGACT
TCAAGGGCATGGTGGTCAAGGCGATCAAGGTGGACGGCATCGTGGACATAGAGTTTGACGACGACCGCGTGGTCA
AGAGCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail