Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1582
Gene name
LocationContig_1351:5738..6957
Strand-
Gene length (bp)1219
Transcript length (bp)1077
Coding sequence length (bp)1077
Protein length (aa) 359

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00098 zf-CCHC Zinc knuckle 3.5E-05 94 110
PF00098 zf-CCHC Zinc knuckle 7.7E-06 119 134
PF13917 zf-CCHC_3 Zinc knuckle 8.1E-04 91 110
PF13917 zf-CCHC_3 Zinc knuckle 3.5E-01 115 135

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NIW7|BBP_NEUCR Branchpoint-bridging protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bbp-1 PE=3 SV=1 1 276 1.0E-129
sp|Q4WXV6|BBP_ASPFU Branchpoint-bridging protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bbp PE=3 SV=1 1 275 3.0E-110
sp|O74555|BBP_SCHPO Branchpoint-bridging protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bpb1 PE=1 SV=1 1 179 2.0E-68
sp|P0CO44|BBP_CRYNJ Branchpoint-bridging protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BBP PE=3 SV=1 1 184 6.0E-55
sp|P0CO45|BBP_CRYNB Branchpoint-bridging protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BBP PE=3 SV=1 1 184 6.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NIW7|BBP_NEUCR Branchpoint-bridging protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bbp-1 PE=3 SV=1 1 276 1.0E-129
sp|Q4WXV6|BBP_ASPFU Branchpoint-bridging protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bbp PE=3 SV=1 1 275 3.0E-110
sp|O74555|BBP_SCHPO Branchpoint-bridging protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bpb1 PE=1 SV=1 1 179 2.0E-68
sp|P0CO44|BBP_CRYNJ Branchpoint-bridging protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BBP PE=3 SV=1 1 184 6.0E-55
sp|P0CO45|BBP_CRYNB Branchpoint-bridging protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BBP PE=3 SV=1 1 184 6.0E-55
sp|Q4P0H7|BBP_USTMA Branchpoint-bridging protein OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BBP PE=3 SV=1 1 177 1.0E-51
sp|Q6C187|BBP_YARLI Branchpoint-bridging protein OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BBP PE=3 SV=1 1 279 4.0E-47
sp|Q6FW77|BBP_CANGA Branchpoint-bridging protein OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BBP PE=3 SV=1 1 133 2.0E-40
sp|Q12186|BBP_YEAST Branchpoint-bridging protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSL5 PE=1 SV=1 1 150 2.0E-39
sp|Q750X2|BBP_ASHGO Branchpoint-bridging protein OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BBP PE=3 SV=2 1 133 2.0E-34
sp|Q64213|SF01_MOUSE Splicing factor 1 OS=Mus musculus GN=Sf1 PE=1 SV=6 1 192 5.0E-29
sp|Q15637|SF01_HUMAN Splicing factor 1 OS=Homo sapiens GN=SF1 PE=1 SV=4 1 192 8.0E-29
sp|Q5AED9|BBP_CANAL Branchpoint-bridging protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BBP PE=3 SV=1 1 133 3.0E-26
sp|Q6BSP4|BBP_DEBHA Branchpoint-bridging protein OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BBP PE=3 SV=2 1 136 2.0E-23
sp|Q54BM5|BBP_DICDI Branchpoint-bridging protein OS=Dictyostelium discoideum GN=sf1 PE=3 SV=1 1 113 3.0E-18
sp|Q17339|GLD1_CAEEL Female germline-specific tumor suppressor gld-1 OS=Caenorhabditis elegans GN=gld-1 PE=1 SV=1 1 88 2.0E-10
sp|Q6P104|QKIB_DANRE Protein quaking-B OS=Danio rerio GN=qkib PE=2 SV=1 1 89 7.0E-10
sp|Q5W9D7|QKI_BOVIN Protein quaking OS=Bos taurus GN=QKI PE=2 SV=1 1 89 7.0E-10
sp|Q9GMY1|QKI_CANLF Protein quaking OS=Canis lupus familiaris GN=QKI PE=2 SV=1 1 89 7.0E-10
sp|Q7JJZ8|QKI_FELCA Protein quaking OS=Felis catus GN=QKI PE=2 SV=1 1 89 7.0E-10
sp|Q5W9D6|QKI_HORSE Protein quaking OS=Equus caballus GN=QKI PE=2 SV=1 1 89 7.0E-10
sp|Q96PU8|QKI_HUMAN Protein quaking OS=Homo sapiens GN=QKI PE=1 SV=1 1 89 7.0E-10
sp|Q9QYS9|QKI_MOUSE Protein quaking OS=Mus musculus GN=Qki PE=1 SV=1 1 89 7.0E-10
sp|Q5W9D5|QKI_PIG Protein quaking OS=Sus scrofa GN=QKI PE=2 SV=1 1 89 7.0E-10
sp|Q91XU1|QKI_RAT Protein quaking OS=Rattus norvegicus GN=Qki PE=1 SV=2 1 89 8.0E-10
sp|Q9YH18|QKI_CHICK Protein quaking OS=Gallus gallus GN=QKI PE=2 SV=2 1 89 9.0E-10
sp|Q32NN2|QKIA_XENLA Protein quaking-A OS=Xenopus laevis GN=qki-a PE=1 SV=2 1 89 1.0E-09
sp|Q6IRN2|QKIB_XENLA Protein quaking-B OS=Xenopus laevis GN=qki-b PE=1 SV=1 1 89 1.0E-09
sp|O01367|HOW_DROME Protein held out wings OS=Drosophila melanogaster GN=how PE=1 SV=1 1 117 2.0E-09
sp|Q8GYR4|QKIL4_ARATH KH domain-containing protein At3g08620 OS=Arabidopsis thaliana GN=At3g08620 PE=2 SV=1 1 90 3.0E-09
sp|Q6P0D0|QKIA_DANRE Protein quaking-A OS=Danio rerio GN=qkia PE=2 SV=2 1 94 6.0E-09
sp|Q75GR5|SPIN1_ORYSJ KH domain-containing protein SPIN1 OS=Oryza sativa subsp. japonica GN=SPIN1 PE=1 SV=1 1 90 6.0E-08
sp|Q8GWR3|QKIL5_ARATH KH domain-containing protein At1g09660/At1g09670 OS=Arabidopsis thaliana GN=At1g09660 PE=2 SV=1 1 90 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1582
MEADSGAKIAIRGKGSVKEGKGRSDAAHSSNQEEDLHCLIMADTEEKINKAKQLIHNVIETAASIPEGQNELKRN
QLRELAALNGTLRDDENQACQNCGKIGHRKYDCPERQNFTASIICRVCGNAGHMARDCPDRQRGASWRNHDVNGG
RHAGRIGGGGGGDAVDREMEQLMQELGGGPGGAPAQIEAGPGGHDDRDAKPWHRGPTGGPAPWRSRHHDSHHDGG
SGGSGGGHGGSSAPWARERHRGHDHHGDGYHGHSSYGSGGGSGHGSAPWHQPAPGTHGGYHGYSGGYGGYGGAPG
TGSAPGPPPGLGPSGGAPGMGGSSDPYQHYPPPPPPSGESPPPPPPSNQPPPPPPPGA*
Coding >Hirsu2|1582
ATGGAGGCGGACTCGGGTGCCAAGATTGCCATCCGTGGCAAGGGCTCCGTCAAGGAGGGCAAGGGACGTTCCGAC
GCTGCTCACTCCAGCAACCAAGAAGAGGATCTCCACTGCCTCATCATGGCCGACACCGAGGAGAAGATCAACAAG
GCCAAGCAGCTGATCCACAACGTCATCGAGACGGCCGCTTCCATCCCTGAGGGGCAGAACGAGCTCAAGCGGAAC
CAGCTTCGAGAGCTGGCCGCGCTCAACGGAACGTTGCGTGACGACGAGAACCAGGCCTGCCAGAACTGCGGTAAG
ATCGGACACCGCAAGTATGATTGCCCTGAGCGACAGAACTTCACTGCGAGCATCATCTGCCGCGTTTGCGGCAAT
GCCGGTCATATGGCACGTGACTGTCCCGACCGCCAGAGAGGTGCCAGCTGGCGCAACCACGACGTCAACGGCGGT
CGTCACGCTGGCAGGATTGGCGGCGGCGGCGGCGGCGACGCTGTTGATCGCGAGATGGAGCAACTCATGCAAGAG
CTTGGCGGAGGTCCTGGCGGCGCTCCGGCCCAGATCGAAGCCGGCCCGGGCGGCCACGACGACAGAGACGCCAAG
CCCTGGCACCGCGGCCCGACTGGCGGACCCGCTCCGTGGCGCTCGCGTCACCACGACTCTCATCATGATGGAGGC
TCCGGCGGCTCCGGAGGAGGCCACGGCGGCTCGTCGGCCCCCTGGGCTCGAGAGCGTCATCGCGGACACGACCAT
CACGGCGACGGCTACCACGGCCACTCGTCGTATGGCTCCGGCGGCGGCTCGGGCCATGGCTCTGCCCCGTGGCAC
CAGCCTGCGCCCGGAACTCATGGCGGCTACCACGGATACTCGGGAGGGTACGGTGGCTACGGCGGAGCGCCGGGC
ACGGGTTCTGCCCCCGGCCCGCCCCCCGGCCTCGGACCGTCGGGCGGAGCCCCCGGCATGGGCGGATCGAGCGAC
CCGTATCAGCACTACCCCCCGCCGCCTCCTCCGTCGGGAGAGTCCCCGCCCCCTCCTCCCCCGAGCAACCAGCCA
CCGCCGCCTCCGCCTCCCGGCGCATAG
Transcript >Hirsu2|1582
ATGGAGGCGGACTCGGGTGCCAAGATTGCCATCCGTGGCAAGGGCTCCGTCAAGGAGGGCAAGGGACGTTCCGAC
GCTGCTCACTCCAGCAACCAAGAAGAGGATCTCCACTGCCTCATCATGGCCGACACCGAGGAGAAGATCAACAAG
GCCAAGCAGCTGATCCACAACGTCATCGAGACGGCCGCTTCCATCCCTGAGGGGCAGAACGAGCTCAAGCGGAAC
CAGCTTCGAGAGCTGGCCGCGCTCAACGGAACGTTGCGTGACGACGAGAACCAGGCCTGCCAGAACTGCGGTAAG
ATCGGACACCGCAAGTATGATTGCCCTGAGCGACAGAACTTCACTGCGAGCATCATCTGCCGCGTTTGCGGCAAT
GCCGGTCATATGGCACGTGACTGTCCCGACCGCCAGAGAGGTGCCAGCTGGCGCAACCACGACGTCAACGGCGGT
CGTCACGCTGGCAGGATTGGCGGCGGCGGCGGCGGCGACGCTGTTGATCGCGAGATGGAGCAACTCATGCAAGAG
CTTGGCGGAGGTCCTGGCGGCGCTCCGGCCCAGATCGAAGCCGGCCCGGGCGGCCACGACGACAGAGACGCCAAG
CCCTGGCACCGCGGCCCGACTGGCGGACCCGCTCCGTGGCGCTCGCGTCACCACGACTCTCATCATGATGGAGGC
TCCGGCGGCTCCGGAGGAGGCCACGGCGGCTCGTCGGCCCCCTGGGCTCGAGAGCGTCATCGCGGACACGACCAT
CACGGCGACGGCTACCACGGCCACTCGTCGTATGGCTCCGGCGGCGGCTCGGGCCATGGCTCTGCCCCGTGGCAC
CAGCCTGCGCCCGGAACTCATGGCGGCTACCACGGATACTCGGGAGGGTACGGTGGCTACGGCGGAGCGCCGGGC
ACGGGTTCTGCCCCCGGCCCGCCCCCCGGCCTCGGACCGTCGGGCGGAGCCCCCGGCATGGGCGGATCGAGCGAC
CCGTATCAGCACTACCCCCCGCCGCCTCCTCCGTCGGGAGAGTCCCCGCCCCCTCCTCCCCCGAGCAACCAGCCA
CCGCCGCCTCCGCCTCCCGGCGCATAG
Gene >Hirsu2|1582
ATGGAGGCGGACTCGGGTGCCAAGATTGCCATCCGTGGCAAGGGCTCCGTCAAGGAGGGCAAGGGACGTTCCGAC
GCTGCTCACTCCAGCAACCAAGAAGAGGATCTCCACTGCCTCATCATGGCCGACACCGAGGAGAAGATCAACAAG
GCCAAGCAGCTGATCCACAACGTCATCGAGACGGTGAGTATACCTGAACCCGTCCCAGACACGTCCGTTCACGAA
GCGTTGTCGCTGACCTTGCCGTGCCAGGCCGCTTCCATCCCTGAGGGGCAGAACGAGCTCAAGCGGAACCAGCTT
CGAGAGCTGGCCGCGCTCAACGGAACGTTGCGTGACGACGAGAACCAGGCCTGCCAGAACTGCGGTAAGATCGGA
CACCGCAAGTATGATTGCCCTGAGCGACAGAACTTCACTGCGAGCATCATCTGCCGCGTTTGCGGCAATGCCGGT
CATATGGCACGTGACTGTCCCGACCGCCAGAGAGGTGCCAGCTGGCGCAACCACGACGTCAACGGCGGTCGTCAC
GCTGGCAGGATTGGCGGCGGCGGCGGCGGCGACGCTGTTGATCGCGAGATGGAGGTACGCTCCCCCATATTCTCC
ATGTCTCTCTCCTCCTTGTTCGGCTCACGATCGGTGCTAACGACGAGTGCAGCAACTCATGCAAGAGCTTGGCGG
AGGTCCTGGCGGCGCTCCGGCCCAGATCGAAGCCGGCCCGGGCGGCCACGACGACAGAGACGCCAAGCCCTGGCA
CCGCGGCCCGACTGGCGGACCCGCTCCGTGGCGCTCGCGTCACCACGACTCTCATCATGATGGAGGCTCCGGCGG
CTCCGGAGGAGGCCACGGCGGCTCGTCGGCCCCCTGGGCTCGAGAGCGTCATCGCGGACACGACCATCACGGCGA
CGGCTACCACGGCCACTCGTCGTATGGCTCCGGCGGCGGCTCGGGCCATGGCTCTGCCCCGTGGCACCAGCCTGC
GCCCGGAACTCATGGCGGCTACCACGGATACTCGGGAGGGTACGGTGGCTACGGCGGAGCGCCGGGCACGGGTTC
TGCCCCCGGCCCGCCCCCCGGCCTCGGACCGTCGGGCGGAGCCCCCGGCATGGGCGGATCGAGCGACCCGTATCA
GCACTACCCCCCGCCGCCTCCTCCGTCGGGAGAGTCCCCGCCCCCTCCTCCCCCGAGCAACCAGCCACCGCCGCC
TCCGCCTCCCGGCGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail