Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1579
Gene name
LocationContig_1350:4968..5794
Strand-
Gene length (bp)826
Transcript length (bp)618
Coding sequence length (bp)618
Protein length (aa) 206

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00187 Chitin_bind_1 Chitin recognition protein 3.4E-07 148 182

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008061 chitin binding Yes
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1579
MIGTYPVFSAESIPPEQSIKQVGSGNTDINNDMGLDYVFLAPTYTNNPDEGCTSFEFILQYEPLDGSQELAPGSS
GPGRYLGCKRHSPGKSKIRRVALYRKSGSAITLDDVKRNNYEGMTADINKDRGGDFLSLVWSSYKDPEDVKWRCG
PKGQNRSCKNGQCCSISGWCSNSPEHCGYGCQFKFGFCDATVSRPVPCLACRQRG*
Coding >Hirsu2|1579
ATGATTGGTACATATCCGGTCTTCAGCGCCGAAAGCATCCCGCCGGAACAGAGCATCAAGCAGGTGGGATCTGGC
AATACCGACATTAACAACGATATGGGTTTAGACTATGTCTTTCTCGCTCCGACCTATACCAACAACCCCGACGAA
GGCTGCACGTCCTTTGAATTTATCCTTCAGTACGAGCCCCTGGACGGTTCGCAAGAGCTGGCTCCGGGCTCGAGC
GGGCCGGGTCGGTACCTCGGGTGCAAAAGGCATTCGCCGGGCAAGAGCAAAATCCGACGAGTCGCGCTGTATCGG
AAGTCCGGGAGCGCCATCACGTTGGACGATGTGAAGCGGAACAACTATGAAGGCATGACGGCCGACATCAACAAG
GACCGCGGCGGCGACTTCCTGAGCCTCGTCTGGTCCTCGTACAAAGATCCGGAGGACGTGAAATGGAGATGTGGT
CCCAAGGGCCAGAACAGGTCCTGCAAGAATGGGCAATGCTGCTCCATCTCGGGCTGGTGCAGCAACAGCCCCGAG
CACTGCGGATACGGCTGTCAGTTCAAATTCGGCTTCTGCGACGCTACCGTGAGTCGCCCCGTTCCCTGTCTGGCC
TGTCGGCAACGAGGCTGA
Transcript >Hirsu2|1579
ATGATTGGTACATATCCGGTCTTCAGCGCCGAAAGCATCCCGCCGGAACAGAGCATCAAGCAGGTGGGATCTGGC
AATACCGACATTAACAACGATATGGGTTTAGACTATGTCTTTCTCGCTCCGACCTATACCAACAACCCCGACGAA
GGCTGCACGTCCTTTGAATTTATCCTTCAGTACGAGCCCCTGGACGGTTCGCAAGAGCTGGCTCCGGGCTCGAGC
GGGCCGGGTCGGTACCTCGGGTGCAAAAGGCATTCGCCGGGCAAGAGCAAAATCCGACGAGTCGCGCTGTATCGG
AAGTCCGGGAGCGCCATCACGTTGGACGATGTGAAGCGGAACAACTATGAAGGCATGACGGCCGACATCAACAAG
GACCGCGGCGGCGACTTCCTGAGCCTCGTCTGGTCCTCGTACAAAGATCCGGAGGACGTGAAATGGAGATGTGGT
CCCAAGGGCCAGAACAGGTCCTGCAAGAATGGGCAATGCTGCTCCATCTCGGGCTGGTGCAGCAACAGCCCCGAG
CACTGCGGATACGGCTGTCAGTTCAAATTCGGCTTCTGCGACGCTACCGTGAGTCGCCCCGTTCCCTGTCTGGCC
TGTCGGCAACGAGGCTGA
Gene >Hirsu2|1579
ATGATTGGTACATATCCGGTCTTCAGGTACGGTTCTCTGCCTCGCAACCCACACGTCTTTGTCGTTTCCGCTCAC
CGCCGCCGGACAGGTGCTTTATAGCGCCGAAAGCATCCCGCCGGAACAGAGCATCAAGCAGGTGGGATCTGGCAA
TACCGACATTAACAACGATATGGGTTTAGAGTGAGCCATGGCTTCTCCTTTGACCGGATCCTGACTCTGACAACT
CTGCCTTAGCTATGTCTTTCTCGCTCCGACCTATACCAACAACCCCGACGAAGGCTGCACGTCCTTTGAATTTAT
CCTTCAGTACGAGCCCCTGGACGGTTCGCAAGAGCTGGCTCCGGGCTCGAGCGGGCCGGGTCGGTACCTCGGGTG
CAAAAGGCATTCGCCGGGCAAGAGCAAAATCCGACGAGTCGCGCTGTATCGGAAGTCCGGGAGCGCCATCACGTT
GGACGATGTGAAGCGGAACAACTATGAAGGCATGACGGCCGACATCAACAAGGACCGCGGCGGCGACTTCCTGAG
CCTCGTCTGGTCCTCGTACAAAGATCCGGTAAGTAGCTCTCCTCCCGCCCACCGGCTCCATCGCCCGTCCTCTCT
CCGAGCGCTGACGGGTGCGGCGGCCAACGGGCAGGAGGACGTGAAATGGAGATGTGGTCCCAAGGGCCAGAACAG
GTCCTGCAAGAATGGGCAATGCTGCTCCATCTCGGGCTGGTGCAGCAACAGCCCCGAGCACTGCGGATACGGCTG
TCAGTTCAAATTCGGCTTCTGCGACGCTACCGTGAGTCGCCCCGTTCCCTGTCTGGCCTGTCGGCAACGAGGCTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail