Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1578
Gene name
LocationContig_1350:3024..4194
Strand-
Gene length (bp)1170
Transcript length (bp)1170
Coding sequence length (bp)1170
Protein length (aa) 390

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 4.7E-42 119 364

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29118|ALP_ACRCH Alkaline proteinase OS=Acremonium chrysogenum GN=ALP PE=3 SV=1 48 376 9.0E-64
sp|Q03420|ALP_HYPAT Alkaline proteinase OS=Hypocrea atroviridis GN=prb1 PE=1 SV=1 48 377 1.0E-62
sp|P12547|ORYZ_ASPOR Alkaline protease 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=alp1 PE=1 SV=2 81 377 3.0E-61
sp|B8N106|ORYZ_ASPFN Alkaline protease 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=alp1 PE=1 SV=1 81 377 3.0E-61
sp|P35211|ORYZ_ASPFL Alkaline protease 1 OS=Aspergillus flavus GN=alp1 PE=1 SV=1 50 377 7.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29118|ALP_ACRCH Alkaline proteinase OS=Acremonium chrysogenum GN=ALP PE=3 SV=1 48 376 9.0E-64
sp|Q03420|ALP_HYPAT Alkaline proteinase OS=Hypocrea atroviridis GN=prb1 PE=1 SV=1 48 377 1.0E-62
sp|P12547|ORYZ_ASPOR Alkaline protease 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=alp1 PE=1 SV=2 81 377 3.0E-61
sp|B8N106|ORYZ_ASPFN Alkaline protease 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=alp1 PE=1 SV=1 81 377 3.0E-61
sp|P35211|ORYZ_ASPFL Alkaline protease 1 OS=Aspergillus flavus GN=alp1 PE=1 SV=1 50 377 7.0E-61
sp|Q00208|ORYZ_EMENI Alkaline protease 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alp1 PE=2 SV=1 81 374 6.0E-60
sp|A1CWF3|ORYZ_NEOFI Alkaline protease 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=alp1 PE=2 SV=1 81 377 4.0E-59
sp|A1CIA7|ORYZ_ASPCL Alkaline protease 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=alp1 PE=3 SV=1 81 377 5.0E-59
sp|P28296|ORYZ_ASPFU Alkaline protease 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alp1 PE=1 SV=2 81 377 2.0E-58
sp|B0Y708|ORYZ_ASPFC Alkaline protease 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=alp1 PE=3 SV=1 81 377 2.0E-58
sp|Q9Y778|SMP1_MAGPO Subtilisin-like proteinase Mp1 OS=Magnaporthiopsis poae PE=1 SV=1 76 374 2.0E-52
sp|Q9UTS0|PSP3_SCHPO Subtilase-type proteinase psp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psp3 PE=2 SV=1 56 375 5.0E-52
sp|P87184|ALP2_ASPFU Alkaline protease 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alp2 PE=1 SV=1 56 383 8.0E-52
sp|B0Y473|ALP2_ASPFC Alkaline protease 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=alp2 PE=3 SV=1 56 383 8.0E-52
sp|C5P906|SUB2B_COCP7 Subtilisin-like protease CPC735_003880 OS=Coccidioides posadasii (strain C735) GN=CPC735_003880 PE=3 SV=1 80 374 1.0E-50
sp|L8GD75|SUB3_PSED2 Subtilisin-like protease 3 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP3 PE=3 SV=1 81 375 2.0E-50
sp|C5NZ70|SUB2C_COCP7 Subtilisin-like protease CPC735_013710 OS=Coccidioides posadasii (strain C735) GN=CPC735_013710 PE=3 SV=1 82 374 3.0E-50
sp|C5P4Z8|SUB8_COCP7 Subtilisin-like protease CPC735_031240 OS=Coccidioides posadasii (strain C735) GN=CPC735_031240 PE=3 SV=1 53 374 3.0E-50
sp|L8G6I7|SUB1_PSED2 Subtilisin-like protease 1 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP1 PE=1 SV=1 82 376 4.0E-50
sp|D4DLI5|SUB2_TRIVH Subtilisin-like protease 2 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB2 PE=3 SV=2 80 374 4.0E-49
sp|Q5VJ76|SUB2_TRIVC Subtilisin-like protease 2 OS=Trichophyton verrucosum GN=SUB2 PE=3 SV=2 80 374 5.0E-49
sp|L8FSM5|SUB2_PSED2 Subtilisin-like protease 2 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP2 PE=3 SV=1 82 376 5.0E-49
sp|D4AZ75|SUB2_ARTBC Subtilisin-like protease 2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB2 PE=2 SV=2 80 374 1.0E-48
sp|Q64K35|SUB2_ARTBE Subtilisin-like protease 2 OS=Arthroderma benhamiae GN=SUB2 PE=3 SV=2 80 374 2.0E-48
sp|B6VA85|SUB2_TRIEQ Subtilisin-like protease 2 OS=Trichophyton equinum GN=SUB2 PE=3 SV=1 80 338 2.0E-48
sp|B8XGQ5|SUB2_TRITO Subtilisin-like protease 2 OS=Trichophyton tonsurans GN=SUB2 PE=3 SV=2 80 338 4.0E-48
sp|P09232|PRTB_YEAST Cerevisin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRB1 PE=1 SV=1 82 381 7.0E-48
sp|D4DKQ4|SUB8_TRIVH Subtilisin-like protease 8 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB8 PE=3 SV=1 53 374 9.0E-48
sp|C5G168|SUB2_ARTOC Subtilisin-like protease 2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB2 PE=3 SV=1 80 340 1.0E-47
sp|D4AX50|SUB8_ARTBC Subtilisin-like protease 8 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB8 PE=3 SV=1 53 374 1.0E-47
sp|C5FII2|SUB8_ARTOC Subtilisin-like protease 8 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB8 PE=3 SV=1 53 374 1.0E-47
sp|Q69F57|SUB2_TRIRU Subtilisin-like protease 2 OS=Trichophyton rubrum GN=SUB2 PE=3 SV=2 80 339 2.0E-47
sp|E4UZP9|SUB2_ARTGP Subtilisin-like protease 2 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB2 PE=3 SV=1 23 338 2.0E-47
sp|C5PCX1|SUB7B_COCP7 Subtilisin-like protease CPC735_015300 OS=Coccidioides posadasii (strain C735) GN=CPC735_015300 PE=3 SV=1 33 332 3.0E-47
sp|P40903|ISP6_SCHPO Sexual differentiation process putative subtilase-type proteinase isp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp6 PE=2 SV=1 23 374 5.0E-47
sp|Q69F58|SUB1_TRIRU Subtilisin-like protease 1 OS=Trichophyton rubrum GN=SUB1 PE=2 SV=1 42 378 7.0E-47
sp|C5P1W9|SU11A_COCP7 Subtilisin-like protease CPC735_035780 OS=Coccidioides posadasii (strain C735) GN=CPC735_035780 PE=3 SV=1 81 378 2.0E-46
sp|P33295|PEPC_ASPNG Subtilisin-like serine protease pepC OS=Aspergillus niger GN=pepC PE=3 SV=1 54 370 8.0E-46
sp|C5PCB1|SUB4A_COCP7 Subtilisin-like protease CPC735_066880 OS=Coccidioides posadasii (strain C735) GN=CPC735_066880 PE=3 SV=1 80 374 1.0E-45
sp|P25036|YSP3_YEAST Subtilisin-like protease 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP3 PE=2 SV=2 28 379 3.0E-45
sp|P23653|PRTR_ENGAL Proteinase R OS=Engyodontium album GN=PROR PE=1 SV=1 49 375 4.0E-45
sp|D4DIW9|SUB1_TRIVH Subtilisin-like protease 1 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB1 PE=3 SV=1 42 378 5.0E-45
sp|D4AKU9|SUB1_ARTBC Subtilisin-like protease 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB1 PE=2 SV=2 42 378 6.0E-45
sp|Q5VJ77|SUB1_TRIVC Subtilisin-like protease 1 (Fragment) OS=Trichophyton verrucosum GN=SUB1 PE=3 SV=1 42 377 7.0E-45
sp|Q64K30|SUB1_ARTBE Subtilisin-like protease 1 (Fragment) OS=Arthroderma benhamiae GN=SUB1 PE=3 SV=1 42 377 7.0E-45
sp|E4UPZ4|SUB1_ARTGP Subtilisin-like protease 1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB1 PE=3 SV=1 42 378 1.0E-44
sp|P06873|PRTK_ENGAL Proteinase K OS=Engyodontium album GN=PROK PE=1 SV=2 49 375 8.0E-44
sp|Q8J0D8|SUB2_ARTOT Subtilisin-like protease 2 OS=Arthroderma otae GN=SUB2 PE=3 SV=2 80 340 9.0E-44
sp|G1X8P8|SPAZ_ARTOA Cuticle-degrading serine protease OS=Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491) PE=1 SV=1 49 377 2.0E-43
sp|B8XGQ4|SUB1_TRITO Subtilisin-like protease 1 OS=Trichophyton tonsurans GN=SUB1 PE=3 SV=1 42 382 2.0E-43
sp|B6VA84|SUB1_TRIEQ Subtilisin-like protease 1 OS=Trichophyton equinum GN=SUB1 PE=3 SV=1 42 382 3.0E-43
sp|P58371|SPM1_MAGO7 Subtilisin-like proteinase Spm1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SPM1 PE=3 SV=1 48 374 3.0E-43
sp|C5P6D1|SUB2A_COCP7 Subtilisin-like protease CPC735_023170 OS=Coccidioides posadasii (strain C735) GN=CPC735_023170 PE=3 SV=1 57 378 1.0E-42
sp|C5PFR5|SU11B_COCP7 Subtilisin-like protease CPC735_047380 OS=Coccidioides posadasii (strain C735) GN=CPC735_047380 PE=3 SV=1 81 338 4.0E-41
sp|C5G1D1|SUB5_ARTOC Subtilisin-like protease 5 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB5 PE=3 SV=1 42 346 1.0E-40
sp|A1XIH3|SUB7_TRIEQ Subtilisin-like protease 7 OS=Trichophyton equinum GN=SUB7 PE=1 SV=1 88 354 1.0E-40
sp|A1XIH6|SUB7_TRIVO Subtilisin-like protease 7 OS=Trichophyton violaceum GN=SUB7 PE=1 SV=1 88 332 2.0E-40
sp|P29138|CUDP_METAN Cuticle-degrading protease OS=Metarhizium anisopliae GN=PR1 PE=1 SV=1 81 374 2.0E-40
sp|A1XIH4|SUB7_TRITO Subtilisin-like protease 7 OS=Trichophyton tonsurans GN=SUB7 PE=1 SV=1 88 354 2.0E-40
sp|Q8NID9|SUB7_TRIRU Subtilisin-like protease 7 OS=Trichophyton rubrum GN=SUB7 PE=2 SV=1 88 332 5.0E-40
sp|Q3ZEJ8|SUB6_TRITO Subtilisin-like protease 6 OS=Trichophyton tonsurans GN=SUB6 PE=3 SV=1 53 354 6.0E-40
sp|Q5VJ71|SUB7_TRIVC Subtilisin-like protease 7 OS=Trichophyton verrucosum GN=SUB7 PE=3 SV=1 88 332 7.0E-40
sp|P80146|SEPR_THESR Extracellular serine proteinase OS=Thermus sp. (strain Rt41A) PE=1 SV=3 37 371 7.0E-40
sp|A1XIH0|SUB6_TRIEQ Subtilisin-like protease 6 OS=Trichophyton equinum GN=SUB6 PE=1 SV=1 53 354 7.0E-40
sp|C5FJA5|SUB7_ARTOC Subtilisin-like protease 7 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB7 PE=3 SV=1 52 332 8.0E-40
sp|Q64K36|SUB7_ARTBE Subtilisin-like protease 7 OS=Arthroderma benhamiae GN=SUB7 PE=1 SV=1 88 332 1.0E-39
sp|Q5VJ72|SUB6_TRIVC Subtilisin-like protease 6 OS=Trichophyton verrucosum GN=SUB6 PE=3 SV=1 53 354 1.0E-39
sp|D4CZQ4|SUB7_TRIVH Subtilisin-like protease 7 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB7 PE=3 SV=2 88 332 1.0E-39
sp|D4D5H3|SUB6_TRIVH Subtilisin-like protease 6 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB6 PE=3 SV=1 53 354 1.0E-39
sp|C5FPS1|SUB1_ARTOC Subtilisin-like protease 1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB1 PE=3 SV=1 82 379 2.0E-39
sp|Q8J0D9|SUB1_ARTOT Subtilisin-like protease 1 OS=Arthroderma otae GN=SUB1 PE=3 SV=1 82 379 2.0E-39
sp|C5NZ69|SUB7C_COCP7 Subtilisin-like protease CPC735_013700 OS=Coccidioides posadasii (strain C735) GN=CPC735_013700 PE=3 SV=1 110 375 2.0E-39
sp|D4APA9|SUB7_ARTBC Subtilisin-like protease 7 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB7 PE=1 SV=2 88 332 2.0E-39
sp|C5P5Q3|SUB9_COCP7 Subtilisin-like protease CPC735_033790 OS=Coccidioides posadasii (strain C735) GN=CPC735_033790 PE=3 SV=1 99 375 2.0E-39
sp|A1XIH5|SUB7_TRISD Subtilisin-like protease 7 OS=Trichophyton soudanense GN=SUB7 PE=1 SV=1 88 332 3.0E-39
sp|A1XIH1|SUB6_TRISD Subtilisin-like protease 6 OS=Trichophyton soudanense GN=SUB6 PE=1 SV=1 53 357 3.0E-39
sp|Q9UW97|SUB6_TRIRU Subtilisin-like protease 6 OS=Trichophyton rubrum GN=SUB6 PE=1 SV=1 53 357 3.0E-39
sp|P20015|PRTT_ENGAL Proteinase T (Fragment) OS=Engyodontium album GN=PROT PE=1 SV=1 82 374 4.0E-39
sp|Q8J0D7|SUB3_ARTOT Subtilisin-like protease 3 OS=Arthroderma otae GN=SUB3 PE=1 SV=1 42 341 1.0E-38
sp|C5FMY5|SUB3_ARTOC Subtilisin-like protease 3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB3 PE=3 SV=1 42 341 1.0E-38
sp|P09230|AEP_YARLI Alkaline extracellular protease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=XPR2 PE=1 SV=1 44 374 2.0E-38
sp|B8XGQ6|SUB3_TRITO Subtilisin-like protease 3 OS=Trichophyton tonsurans GN=SUB3 PE=3 SV=1 42 341 2.0E-38
sp|Q8J077|SUB6_TRISH Subtilisin-like protease 6 (Fragment) OS=Trichophyton schoenleinii GN=SUB6 PE=1 SV=1 109 354 3.0E-38
sp|Q69F56|SUB3_TRIRU Subtilisin-like protease 3 OS=Trichophyton rubrum GN=SUB3 PE=1 SV=1 42 332 4.0E-38
sp|D4DLA2|SUB3_TRIVH Subtilisin-like protease 3 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB3 PE=3 SV=1 42 341 4.0E-38
sp|Q5VJ75|SUB3_TRIVC Subtilisin-like protease 3 OS=Trichophyton verrucosum GN=SUB3 PE=3 SV=1 42 341 4.0E-38
sp|Q64K34|SUB3_ARTBE Subtilisin-like protease 3 OS=Arthroderma benhamiae GN=SUB3 PE=1 SV=1 42 341 4.0E-38
sp|D4AWY5|SUB3_ARTBC Subtilisin-like protease 3 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB3 PE=1 SV=1 42 341 4.0E-38
sp|Q64K31|SUB6_ARTBE Subtilisin-like protease 6 OS=Arthroderma benhamiae GN=SUB6 PE=3 SV=1 109 354 7.0E-38
sp|D4ALV9|SUB6_ARTBC Subtilisin-like protease 6 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB6 PE=2 SV=1 109 354 7.0E-38
sp|D4B194|SUB5_ARTBC Subtilisin-like protease 5 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB5 PE=3 SV=1 42 324 7.0E-38
sp|E4V2V9|SUB7_ARTGP Subtilisin-like protease 7 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB7 PE=3 SV=1 88 378 1.0E-37
sp|B6VA86|SUB3_TRIEQ Subtilisin-like protease 3 OS=Trichophyton equinum GN=SUB3 PE=3 SV=1 42 341 1.0E-37
sp|C5FH27|SUB9_ARTOC Subtilisin-like protease 9 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB9 PE=3 SV=1 21 341 2.0E-37
sp|E4V2L6|SUB5_ARTGP Subtilisin-like protease 5 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB5 PE=3 SV=1 42 324 5.0E-37
sp|E4UN97|SUB3_ARTGP Subtilisin-like protease 3 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB3 PE=3 SV=1 42 332 7.0E-37
sp|G3FNQ9|SPAZ_ARTOL Cuticle-degrading serine protease OS=Arthrobotrys oligospora PE=1 SV=2 49 332 3.0E-36
sp|E4V4J8|SUB6_ARTGP Subtilisin-like protease 6 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB6 PE=3 SV=1 109 378 4.0E-36
sp|P25381|RRT12_YEAST Subtilase-type proteinase RRT12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRT12 PE=1 SV=1 75 338 9.0E-36
sp|D4D1U5|SUB12_TRIVH Subtilisin-like protease 12 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB12 PE=3 SV=1 32 355 1.0E-35
sp|D4B5N1|SUB9_ARTBC Subtilisin-like protease 9 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB9 PE=3 SV=1 37 356 2.0E-35
sp|Q68GV9|ALP_LECPS Alkaline serine protease ver112 OS=Lecanicillium psalliotae PE=1 SV=1 42 374 3.0E-35
sp|C5FQI3|SUB6_ARTOC Subtilisin-like protease 6 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB6 PE=3 SV=1 79 332 4.0E-35
sp|P16588|PROA_VIBAL Alkaline serine exoprotease A OS=Vibrio alginolyticus GN=proA PE=3 SV=1 60 369 7.0E-35
sp|C5P6L5|SUB4C_COCP7 Subtilisin-like protease CPC735_024010 OS=Coccidioides posadasii (strain C735) GN=CPC735_024010 PE=3 SV=1 82 341 9.0E-35
sp|D4DIS6|SUB10_TRIVH Subtilisin-like protease 10 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB10 PE=3 SV=1 39 341 1.0E-34
sp|E4UY04|SUB12_ARTGP Subtilisin-like protease 12 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB12 PE=3 SV=1 30 377 1.0E-34
sp|P08594|AQL1_THEAQ Aqualysin-1 OS=Thermus aquaticus GN=pstI PE=1 SV=2 82 369 2.0E-34
sp|C5PGK9|SUB7A_COCP7 Subtilisin-like protease CPC735_050320 OS=Coccidioides posadasii (strain C735) GN=CPC735_050320 PE=3 SV=1 62 332 8.0E-34
sp|D4D674|SUB9_TRIVH Subtilisin-like protease 9 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB9 PE=3 SV=1 37 360 9.0E-34
sp|E4UTU7|SUB9_ARTGP Subtilisin-like protease 9 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB9 PE=3 SV=1 41 341 1.0E-33
sp|D4AQA9|SUB12_ARTBC Subtilisin-like protease 12 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB12 PE=3 SV=1 31 355 2.0E-33
sp|C5NZT2|SUB4B_COCP7 Subtilisin-like protease CPC735_012930 OS=Coccidioides posadasii (strain C735) GN=CPC735_012930 PE=3 SV=1 83 346 3.0E-33
sp|D4AQG0|SUB10_ARTBC Subtilisin-like protease 10 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB10 PE=3 SV=2 39 341 4.0E-32
sp|Q69F35|SUB4_TRIRU Subtilisin-like protease 4 OS=Trichophyton rubrum GN=SUB4 PE=1 SV=1 42 332 8.0E-32
sp|D4D6Q4|SUB4_TRIVH Subtilisin-like protease 4 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB4 PE=3 SV=1 42 332 9.0E-32
sp|Q5VJ74|SUB4_TRIVC Subtilisin-like protease 4 OS=Trichophyton verrucosum GN=SUB4 PE=3 SV=1 42 332 9.0E-32
sp|Q64K33|SUB4_ARTBE Subtilisin-like protease 4 OS=Arthroderma benhamiae GN=SUB4 PE=3 SV=1 42 332 9.0E-32
sp|D4AXW3|SUB4_ARTBC Subtilisin-like protease 4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB4 PE=1 SV=2 42 332 9.0E-32
sp|B8XGQ7|SUB4_TRITO Subtilisin-like protease 4 OS=Trichophyton tonsurans GN=SUB4 PE=3 SV=1 42 332 1.0E-31
sp|A7UKV6|SUB4_TRIEQ Subtilisin-like protease 4 (Fragment) OS=Trichophyton equinum GN=SUB4 PE=3 SV=1 42 332 1.0E-31
sp|Q64K32|SUB5_ARTBE Subtilisin-like protease 5 OS=Arthroderma benhamiae GN=SUB5 PE=3 SV=1 42 324 4.0E-31
sp|D4D0F5|SUB5_TRIVH Subtilisin-like protease 5 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB5 PE=3 SV=1 42 324 4.0E-31
sp|Q5VJ73|SUB5_TRIVC Subtilisin-like protease 5 OS=Trichophyton verrucosum GN=SUB5 PE=3 SV=1 42 324 4.0E-31
sp|Q69F34|SUB5_TRIRU Subtilisin-like protease 5 OS=Trichophyton rubrum GN=SUB5 PE=2 SV=1 42 324 4.0E-31
sp|B8XGQ8|SUB5_TRITO Subtilisin-like protease 5 OS=Trichophyton tonsurans GN=SUB5 PE=3 SV=1 42 324 6.0E-31
sp|B6VA87|SUB5_TRIEQ Subtilisin-like protease 5 OS=Trichophyton equinum GN=SUB5 PE=3 SV=1 42 324 6.0E-31
sp|C5FXZ6|SUB4_ARTOC Subtilisin-like protease 4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB4 PE=3 SV=1 42 332 6.0E-31
sp|D4APE3|SUB11_ARTBC Subtilisin-like protease 11 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB11 PE=3 SV=1 81 378 8.0E-31
sp|E4UWA4|SUB4_ARTGP Subtilisin-like protease 4 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB4 PE=3 SV=1 42 332 1.0E-30
sp|D4CZ60|SUB11_TRIVH Subtilisin-like protease 11 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB11 PE=3 SV=1 81 378 4.0E-30
sp|E4V5C5|SUB11_ARTGP Subtilisin-like protease 11 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB11 PE=3 SV=1 82 378 4.0E-29
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 124 362 2.0E-28
sp|C5FX37|SUB10_ARTOC Subtilisin-like protease 10 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB10 PE=3 SV=1 81 378 1.0E-27
sp|C5P9H3|SUB7D_COCP7 Subtilisin-like protease CPC735_005570 OS=Coccidioides posadasii (strain C735) GN=CPC735_005570 PE=3 SV=1 77 355 1.0E-26
sp|Q8SQJ3|SPL1_ENCCU Putative subtilisin-like proteinase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SPL1 PE=2 SV=1 76 355 2.0E-25
sp|P00781|SUBD_BACLI Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 124 357 2.0E-23
sp|Q5JIZ5|TKSP_THEKO Subtilisin-like serine protease OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1689 PE=1 SV=1 162 355 2.0E-22
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 113 373 7.0E-22
sp|P29599|SUBB_BACLE Subtilisin BL OS=Bacillus lentus PE=1 SV=1 111 357 4.0E-21
sp|P04072|THET_THEVU Thermitase OS=Thermoactinomyces vulgaris PE=1 SV=1 117 362 1.0E-20
sp|P41363|ELYA_BACHD Thermostable alkaline protease OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH0855 PE=1 SV=2 68 373 2.0E-20
sp|C5FZ39|SUB11_ARTOC Subtilisin-like protease 11 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB11 PE=3 SV=1 82 378 2.0E-20
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 111 356 2.0E-20
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 111 356 3.0E-20
sp|P04189|SUBT_BACSU Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 111 356 3.0E-20
sp|Q99405|PRTM_BACSK M-protease OS=Bacillus clausii (strain KSM-K16) GN=aprE PE=1 SV=2 57 356 6.0E-20
sp|P29600|SUBS_BACLE Subtilisin Savinase OS=Bacillus lentus PE=1 SV=1 111 357 1.0E-19
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 117 387 1.0E-19
sp|P27693|ELYA_BACAO Alkaline protease OS=Bacillus alcalophilus PE=1 SV=1 74 356 2.0E-19
sp|P41362|ELYA_BACCS Alkaline protease OS=Bacillus clausii PE=1 SV=1 74 356 3.0E-19
sp|P00783|SUBT_BACSA Subtilisin amylosacchariticus OS=Bacillus subtilis subsp. amylosacchariticus GN=apr PE=1 SV=2 111 356 3.0E-19
sp|P29142|SUBT_GEOSE Subtilisin J OS=Geobacillus stearothermophilus GN=aprJ PE=3 SV=1 111 356 3.0E-19
sp|P54423|WPRA_BACSU Cell wall-associated protease OS=Bacillus subtilis (strain 168) GN=wprA PE=1 SV=2 162 328 7.0E-19
sp|O31788|APRX_BACSU Serine protease AprX OS=Bacillus subtilis (strain 168) GN=aprX PE=1 SV=1 117 332 1.0E-18
sp|P29140|ISP_BACCS Intracellular alkaline protease OS=Bacillus clausii PE=3 SV=1 114 331 2.0E-17
sp|P00782|SUBT_BACAM Subtilisin BPN' OS=Bacillus amyloliquefaciens GN=apr PE=1 SV=1 52 357 5.0E-17
sp|P29143|HLY_NATA1 Halolysin OS=Natrialba asiatica (strain ATCC 700177 / DSM 12278 / JCM 9576 / FERM P-10747 / NBRC 102637 / 172P1) GN=hly PE=1 SV=1 124 355 1.0E-16
sp|P20724|ELYA_BACYA Alkaline elastase YaB OS=Bacillus sp. (strain YaB) GN=ale PE=1 SV=1 44 357 2.0E-16
sp|Q80W65|PCSK9_MOUSE Proprotein convertase subtilisin/kexin type 9 OS=Mus musculus GN=Pcsk9 PE=1 SV=2 46 338 4.0E-16
sp|P00780|SUBT_BACLI Subtilisin Carlsberg OS=Bacillus licheniformis GN=apr PE=1 SV=1 124 356 5.0E-16
sp|P58502|TKSU_THEKO Tk-subtilisin OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1675 PE=1 SV=1 124 349 5.0E-16
sp|P59996|PCSK9_RAT Proprotein convertase subtilisin/kexin type 9 OS=Rattus norvegicus GN=Pcsk9 PE=1 SV=1 46 338 9.0E-16
sp|I3R794|HLY_HALMT Halolysin OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=hly PE=1 SV=1 124 374 1.0E-15
sp|P16396|SUBE_BACSU Minor extracellular protease Epr OS=Bacillus subtilis (strain 168) GN=epr PE=2 SV=1 162 332 2.0E-15
sp|P23314|EXPR_XANCP Extracellular protease OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC0851 PE=3 SV=1 42 357 4.0E-15
sp|P42779|BPRV_DICNO Extracellular basic protease OS=Dichelobacter nodosus GN=bprV PE=1 SV=1 117 349 4.0E-15
sp|Q5RLZ1|NEP_NATMA Halolysin-like extracellular serine protease Nep OS=Natrialba magadii GN=nep PE=1 SV=2 166 355 3.0E-14
sp|A8T655|PCSK9_PANPA Proprotein convertase subtilisin/kexin type 9 OS=Pan paniscus GN=PCSK9 PE=2 SV=2 57 326 5.0E-14
sp|A8T658|PCSK9_PONPY Proprotein convertase subtilisin/kexin type 9 OS=Pongo pygmaeus GN=PCSK9 PE=2 SV=1 57 326 5.0E-14
sp|P42780|BPRX_DICNO Extracellular subtilisin-like protease OS=Dichelobacter nodosus PE=3 SV=1 152 349 1.0E-13
sp|A8T688|PCSK9_CALJA Proprotein convertase subtilisin/kexin type 9 OS=Callithrix jacchus GN=PCSK9 PE=2 SV=1 57 326 1.0E-13
sp|A8T695|PCSK9_SAIBB Proprotein convertase subtilisin/kexin type 9 OS=Saimiri boliviensis boliviensis GN=PCSK9 PE=2 SV=1 57 326 1.0E-13
sp|A8T644|PCSK9_PANTR Proprotein convertase subtilisin/kexin type 9 OS=Pan troglodytes GN=PCSK9 PE=2 SV=1 57 326 2.0E-13
sp|A8T650|PCSK9_GORGO Proprotein convertase subtilisin/kexin type 9 OS=Gorilla gorilla gorilla GN=PCSK9 PE=2 SV=1 57 326 2.0E-13
sp|Q8NBP7|PCSK9_HUMAN Proprotein convertase subtilisin/kexin type 9 OS=Homo sapiens GN=PCSK9 PE=1 SV=3 57 326 2.0E-13
sp|A8T6A1|PCSK9_ATEGE Proprotein convertase subtilisin/kexin type 9 OS=Ateles geoffroyi GN=PCSK9 PE=2 SV=1 87 326 2.0E-13
sp|A8T666|PCSK9_MACMU Proprotein convertase subtilisin/kexin type 9 OS=Macaca mulatta GN=PCSK9 PE=2 SV=1 57 326 2.0E-13
sp|A8T662|PCSK9_MACNE Proprotein convertase subtilisin/kexin type 9 OS=Macaca nemestrina GN=PCSK9 PE=2 SV=1 57 326 2.0E-13
sp|A8T6A6|PCSK9_LAGLA Proprotein convertase subtilisin/kexin type 9 OS=Lagothrix lagotricha GN=PCSK9 PE=2 SV=1 87 326 3.0E-13
sp|A8T672|PCSK9_COLGU Proprotein convertase subtilisin/kexin type 9 OS=Colobus guereza GN=PCSK9 PE=2 SV=1 57 326 3.0E-13
sp|A8T677|PCSK9_CALMO Proprotein convertase subtilisin/kexin type 9 OS=Callicebus moloch GN=PCSK9 PE=2 SV=1 57 326 5.0E-13
sp|A8T682|PCSK9_SAGLB Proprotein convertase subtilisin/kexin type 9 OS=Saguinus labiatus GN=PCSK9 PE=2 SV=1 57 326 6.0E-13
sp|P28842|SUBT_BACS9 Subtilisin OS=Bacillus sp. (strain TA39) GN=sub1 PE=1 SV=1 87 332 7.0E-12
sp|Q0WUG6|SBT61_ARATH Subtilisin-like protease SBT6.1 OS=Arabidopsis thaliana GN=SBT6.1 PE=1 SV=1 66 363 6.0E-11
sp|Q8SS86|SPL2_ENCCU Putative subtilisin-like proteinase 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SPL2 PE=2 SV=1 33 330 2.0E-10
sp|Q02470|P2P_LACPA PII-type proteinase OS=Lactobacillus paracasei GN=prtP PE=1 SV=1 117 259 6.0E-08
sp|P15292|P3P_LACLS PIII-type proteinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=prtP PE=1 SV=2 117 259 1.0E-07
sp|P15293|P2P_LACLC PII-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prt PE=3 SV=1 117 259 1.0E-07
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 117 280 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0017171 serine hydrolase activity No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2255 0.1857 0.9257 0.1745 0.2026 0.2608 0.0996 0.1049 0.0725 0.0682

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup46
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3126
Ophiocordyceps australis 1348a (Ghana) OphauG2|3121
Ophiocordyceps australis 1348a (Ghana) OphauG2|2885
Ophiocordyceps australis 1348a (Ghana) OphauG2|1445
Ophiocordyceps australis map64 (Brazil) OphauB2|2218
Ophiocordyceps australis map64 (Brazil) OphauB2|70
Ophiocordyceps australis map64 (Brazil) OphauB2|4868
Ophiocordyceps australis map64 (Brazil) OphauB2|3986
Ophiocordyceps australis map64 (Brazil) OphauB2|1469
Ophiocordyceps australis map64 (Brazil) OphauB2|3181
Ophiocordyceps camponoti-floridani Ophcf2|02561
Ophiocordyceps camponoti-rufipedis Ophun1|3584
Ophiocordyceps kimflemingae Ophio5|993
Ophiocordyceps subramaniannii Hirsu2|8659
Ophiocordyceps subramaniannii Hirsu2|833
Ophiocordyceps subramaniannii Hirsu2|8284
Ophiocordyceps subramaniannii Hirsu2|6950
Ophiocordyceps subramaniannii Hirsu2|523
Ophiocordyceps subramaniannii Hirsu2|5200
Ophiocordyceps subramaniannii Hirsu2|1578 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1378
Ophiocordyceps subramaniannii Hirsu2|11137

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1578
MAFSATRASSRLTCSTIFAATTRHVQTYPCSPFCRGRSSAVLTRDIKVASVEEDGVVQLPRHHVDEEDTTAKSKR
DRGTTTTQFRAPWNLHAISHRTPLSDLRPGCFWTYHHNSRAGEGTYAYVIDTGVRVTHKQFEGRAVHGCTIKPGV
QKCSDDPGDEADSNGHGTHVAGIIAAKTYGVAKKARVVAVKVFDDSGQAKRSETIRAFNWAVNSILENRRAGAAV
INMSWSNKRESDALSAAIDRAFDKGVITVVCAGNQDVPASECSPACAERAITVGSMGRDWTADPYNYGPTVDILA
PGRHIISLSHSNDGALRTLSGTSMAAPHVAGLVLTAMSVHGKRGNQIKPYLIETATKGQVTGPLRGSPNLVANNN
NARQTSPDDTAHCF*
Coding >Hirsu2|1578
ATGGCTTTCTCGGCTACGCGGGCGTCTTCGCGCCTCACGTGCTCGACTATATTCGCAGCCACGACGAGGCACGTG
CAGACCTATCCTTGCTCTCCCTTCTGCCGTGGCAGGTCGTCGGCCGTGCTGACTCGTGACATCAAGGTCGCGTCG
GTGGAGGAGGACGGCGTGGTTCAGCTTCCGCGGCACCACGTCGACGAGGAGGACACGACGGCCAAGTCAAAGCGC
GACCGGGGCACGACGACGACGCAGTTCCGGGCGCCTTGGAACCTGCATGCCATCTCTCACCGGACCCCCCTCTCG
GACCTGCGGCCGGGCTGTTTCTGGACCTATCACCACAACTCCCGGGCGGGCGAGGGCACGTATGCCTATGTCATC
GACACCGGCGTCAGGGTCACGCACAAGCAGTTCGAGGGCCGGGCCGTGCACGGCTGCACCATCAAGCCCGGGGTG
CAAAAGTGCAGCGATGACCCGGGCGACGAGGCCGACAGCAACGGGCACGGGACGCACGTGGCCGGCATCATCGCG
GCCAAGACGTACGGCGTGGCCAAGAAGGCGCGCGTGGTGGCGGTCAAGGTCTTCGACGACAGCGGGCAGGCCAAG
CGGTCCGAGACGATCCGGGCCTTCAACTGGGCCGTCAACAGCATCCTGGAAAACCGTCGGGCCGGGGCGGCCGTC
ATCAACATGTCATGGAGCAACAAGCGCGAGTCGGACGCGCTGAGTGCGGCCATCGACCGAGCCTTCGACAAGGGC
GTCATCACCGTCGTCTGCGCCGGCAACCAGGACGTGCCGGCGTCCGAGTGCTCGCCGGCCTGCGCAGAGCGGGCC
ATCACGGTCGGGAGCATGGGCCGGGACTGGACGGCCGACCCGTACAACTATGGTCCGACCGTCGACATCCTGGCG
CCGGGACGGCACATCATCTCGCTGTCGCACAGCAACGACGGCGCGCTGAGGACCCTGTCCGGCACCTCCATGGCC
GCGCCTCATGTTGCCGGCCTGGTCCTGACCGCCATGTCGGTCCACGGCAAGAGGGGGAACCAGATCAAGCCGTAT
CTCATCGAAACGGCCACCAAGGGGCAAGTCACTGGACCTCTCCGCGGCTCACCCAACCTCGTGGCCAACAACAAC
AACGCCAGGCAGACTTCTCCCGACGACACGGCTCACTGTTTCTAG
Transcript >Hirsu2|1578
ATGGCTTTCTCGGCTACGCGGGCGTCTTCGCGCCTCACGTGCTCGACTATATTCGCAGCCACGACGAGGCACGTG
CAGACCTATCCTTGCTCTCCCTTCTGCCGTGGCAGGTCGTCGGCCGTGCTGACTCGTGACATCAAGGTCGCGTCG
GTGGAGGAGGACGGCGTGGTTCAGCTTCCGCGGCACCACGTCGACGAGGAGGACACGACGGCCAAGTCAAAGCGC
GACCGGGGCACGACGACGACGCAGTTCCGGGCGCCTTGGAACCTGCATGCCATCTCTCACCGGACCCCCCTCTCG
GACCTGCGGCCGGGCTGTTTCTGGACCTATCACCACAACTCCCGGGCGGGCGAGGGCACGTATGCCTATGTCATC
GACACCGGCGTCAGGGTCACGCACAAGCAGTTCGAGGGCCGGGCCGTGCACGGCTGCACCATCAAGCCCGGGGTG
CAAAAGTGCAGCGATGACCCGGGCGACGAGGCCGACAGCAACGGGCACGGGACGCACGTGGCCGGCATCATCGCG
GCCAAGACGTACGGCGTGGCCAAGAAGGCGCGCGTGGTGGCGGTCAAGGTCTTCGACGACAGCGGGCAGGCCAAG
CGGTCCGAGACGATCCGGGCCTTCAACTGGGCCGTCAACAGCATCCTGGAAAACCGTCGGGCCGGGGCGGCCGTC
ATCAACATGTCATGGAGCAACAAGCGCGAGTCGGACGCGCTGAGTGCGGCCATCGACCGAGCCTTCGACAAGGGC
GTCATCACCGTCGTCTGCGCCGGCAACCAGGACGTGCCGGCGTCCGAGTGCTCGCCGGCCTGCGCAGAGCGGGCC
ATCACGGTCGGGAGCATGGGCCGGGACTGGACGGCCGACCCGTACAACTATGGTCCGACCGTCGACATCCTGGCG
CCGGGACGGCACATCATCTCGCTGTCGCACAGCAACGACGGCGCGCTGAGGACCCTGTCCGGCACCTCCATGGCC
GCGCCTCATGTTGCCGGCCTGGTCCTGACCGCCATGTCGGTCCACGGCAAGAGGGGGAACCAGATCAAGCCGTAT
CTCATCGAAACGGCCACCAAGGGGCAAGTCACTGGACCTCTCCGCGGCTCACCCAACCTCGTGGCCAACAACAAC
AACGCCAGGCAGACTTCTCCCGACGACACGGCTCACTGTTTCTAG
Gene >Hirsu2|1578
ATGGCTTTCTCGGCTACGCGGGCGTCTTCGCGCCTCACGTGCTCGACTATATTCGCAGCCACGACGAGGCACGTG
CAGACCTATCCTTGCTCTCCCTTCTGCCGTGGCAGGTCGTCGGCCGTGCTGACTCGTGACATCAAGGTCGCGTCG
GTGGAGGAGGACGGCGTGGTTCAGCTTCCGCGGCACCACGTCGACGAGGAGGACACGACGGCCAAGTCAAAGCGC
GACCGGGGCACGACGACGACGCAGTTCCGGGCGCCTTGGAACCTGCATGCCATCTCTCACCGGACCCCCCTCTCG
GACCTGCGGCCGGGCTGTTTCTGGACCTATCACCACAACTCCCGGGCGGGCGAGGGCACGTATGCCTATGTCATC
GACACCGGCGTCAGGGTCACGCACAAGCAGTTCGAGGGCCGGGCCGTGCACGGCTGCACCATCAAGCCCGGGGTG
CAAAAGTGCAGCGATGACCCGGGCGACGAGGCCGACAGCAACGGGCACGGGACGCACGTGGCCGGCATCATCGCG
GCCAAGACGTACGGCGTGGCCAAGAAGGCGCGCGTGGTGGCGGTCAAGGTCTTCGACGACAGCGGGCAGGCCAAG
CGGTCCGAGACGATCCGGGCCTTCAACTGGGCCGTCAACAGCATCCTGGAAAACCGTCGGGCCGGGGCGGCCGTC
ATCAACATGTCATGGAGCAACAAGCGCGAGTCGGACGCGCTGAGTGCGGCCATCGACCGAGCCTTCGACAAGGGC
GTCATCACCGTCGTCTGCGCCGGCAACCAGGACGTGCCGGCGTCCGAGTGCTCGCCGGCCTGCGCAGAGCGGGCC
ATCACGGTCGGGAGCATGGGCCGGGACTGGACGGCCGACCCGTACAACTATGGTCCGACCGTCGACATCCTGGCG
CCGGGACGGCACATCATCTCGCTGTCGCACAGCAACGACGGCGCGCTGAGGACCCTGTCCGGCACCTCCATGGCC
GCGCCTCATGTTGCCGGCCTGGTCCTGACCGCCATGTCGGTCCACGGCAAGAGGGGGAACCAGATCAAGCCGTAT
CTCATCGAAACGGCCACCAAGGGGCAAGTCACTGGACCTCTCCGCGGCTCACCCAACCTCGTGGCCAACAACAAC
AACGCCAGGCAGACTTCTCCCGACGACACGGCTCACTGTTTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail