Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1572
Gene name
LocationContig_135:24987..27597
Strand-
Gene length (bp)2610
Transcript length (bp)2610
Coding sequence length (bp)2610
Protein length (aa) 870

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 5.0E-07 295 553

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9BX10|GTPB2_HUMAN GTP-binding protein 2 OS=Homo sapiens GN=GTPBP2 PE=1 SV=1 104 849 1.0E-39
sp|Q3UJK4|GTPB2_MOUSE GTP-binding protein 2 OS=Mus musculus GN=Gtpbp2 PE=1 SV=1 104 849 2.0E-39
sp|D2XV59|GTPB1_RAT GTP-binding protein 1 OS=Rattus norvegicus GN=Gtpbp1 PE=1 SV=1 287 627 7.0E-25
sp|O08582|GTPB1_MOUSE GTP-binding protein 1 OS=Mus musculus GN=Gtpbp1 PE=1 SV=2 287 627 8.0E-25
sp|Q58DC5|GTPB1_BOVIN GTP-binding protein 1 OS=Bos taurus GN=GTPBP1 PE=2 SV=2 287 627 9.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9BX10|GTPB2_HUMAN GTP-binding protein 2 OS=Homo sapiens GN=GTPBP2 PE=1 SV=1 104 849 1.0E-39
sp|Q3UJK4|GTPB2_MOUSE GTP-binding protein 2 OS=Mus musculus GN=Gtpbp2 PE=1 SV=1 104 849 2.0E-39
sp|D2XV59|GTPB1_RAT GTP-binding protein 1 OS=Rattus norvegicus GN=Gtpbp1 PE=1 SV=1 287 627 7.0E-25
sp|O08582|GTPB1_MOUSE GTP-binding protein 1 OS=Mus musculus GN=Gtpbp1 PE=1 SV=2 287 627 8.0E-25
sp|Q58DC5|GTPB1_BOVIN GTP-binding protein 1 OS=Bos taurus GN=GTPBP1 PE=2 SV=2 287 627 9.0E-25
sp|Q5R8Q7|GTPB1_PONAB GTP-binding protein 1 (Fragment) OS=Pongo abelii GN=GTPBP1 PE=2 SV=2 287 627 1.0E-24
sp|O00178|GTPB1_HUMAN GTP-binding protein 1 OS=Homo sapiens GN=GTPBP1 PE=1 SV=3 287 627 1.0E-24
sp|Q17045|AGP1_ASCSU GTP-binding protein AGP-1 OS=Ascaris suum GN=AGP-1 PE=2 SV=1 293 627 1.0E-24
sp|Q5XGS8|GTPB1_XENLA GTP-binding protein 1 OS=Xenopus laevis GN=gtpbp1 PE=2 SV=1 285 588 2.0E-24
sp|Q18905|CGP1_CAEEL GTP-binding protein cgp-1 OS=Caenorhabditis elegans GN=cgp-1 PE=2 SV=2 293 627 3.0E-23
sp|Q5UR72|YR624_MIMIV Putative GTP-binding protein R624 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R624 PE=3 SV=1 268 627 1.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0032553 ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0003674 molecular_function No
GO:0032550 purine ribonucleoside binding No
GO:0001883 purine nucleoside binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0032549 ribonucleoside binding No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0032561 guanyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0001882 nucleoside binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1572
MASIFTYDPDPPRVSSPWLASDNAASQAPDRSPAPSSESDGAVTKLQAEPQRGPTEYKLHLLLRPRRVYTFMSTT
GLAGAPSQPGSQETAPLKTAPAVPAASSQPQRERLKHLTTQLLWRLQQSSPYHASSSKELTVPKLPAGSFDLDVP
VKLEALVPGLEESRGALYEIGVSDDGSLIGLTKDEMSESIATLRVMAASLGCLVDVVRTVIVGECAWVEPQGLAD
AASSAPIQETTRAKLWVAEALVTPELGLRRDIPSCELDGSLGDSTGHRAANTPESAGVPSRGSSTTPQVRVTLTG
PTTSGKSSLLGTLSTGTLDNGRGKSRLSLLKHRHEMISGVTSSIAQELVGYKDREILNYSRGNIESWLDIHDCAE
NGRLVFVSDSGGHPRYRRTVLRGLMSWAPHWSILCIAADATDEVTGAVDSASSAQEVPAAAAVGVDLVKAHLTLS
LKLDVPMAIVITKLDLASKFSLHKTMTKVLTAIKEAGRMPKILQPDQRQHDGLKYIPPEDQAKVGSVIDGMMEVE
SQIAQVPIVLTSAVKGTGIGLVHALLASLPLPPAPPPTDGIGTASSPEQPECLFPIDDTFSLPSSYRFPTPVLGR
RAARGVIVSGYVRCGSLSVGDRVVVGPFQPSADDEARVLPMAMGYGSSPGSYGLSISHPSSAELARIAVKNAISA
STTVGEWNVAQIVSIRNLRLPVRALEAGQAGSIGLVFELYTEHADNIDDPPRIRRGMVLALLSKPTMNGGPSLQA
ASGFTATFRDSGIRLLTRGSLVNVYFASVRAAARILRVSCHQVGGCSGASATADLDDILRLTEDLGDLHSQEFRG
EVTLELLHNREWVEVGSRVLLLEGGSQDKSGLEGYVGEVVEIVE*
Coding >Hirsu2|1572
ATGGCATCAATCTTCACTTACGATCCGGATCCCCCGCGCGTATCTTCCCCCTGGCTCGCGTCCGACAATGCTGCC
AGCCAGGCGCCCGACCGCTCTCCTGCCCCAAGCTCCGAATCCGACGGCGCTGTCACCAAGCTTCAGGCAGAGCCT
CAGAGGGGGCCTACCGAGTACAAGCTTCATCTCTTGCTCCGGCCCCGGCGAGTGTACACGTTCATGAGCACGACT
GGACTGGCCGGTGCGCCTTCGCAACCGGGATCGCAGGAAACAGCCCCCCTGAAGACGGCGCCTGCTGTCCCGGCA
GCATCCAGTCAGCCTCAACGTGAAAGACTCAAGCATCTCACTACTCAGCTCCTGTGGAGGCTACAGCAATCTTCT
CCCTACCATGCCTCGAGCTCGAAAGAGCTCACTGTACCGAAGCTGCCGGCTGGCAGCTTCGACCTCGACGTGCCC
GTCAAATTGGAGGCGCTGGTGCCCGGGCTTGAAGAGTCGCGAGGGGCGTTGTACGAGATTGGTGTTTCCGACGAC
GGCTCCCTCATTGGCCTAACCAAGGACGAGATGAGCGAGAGTATTGCAACACTGCGCGTCATGGCTGCTAGTCTG
GGCTGCCTCGTGGACGTCGTTCGTACGGTCATCGTTGGAGAGTGCGCCTGGGTTGAGCCGCAAGGGCTGGCCGAC
GCTGCGAGCTCCGCGCCGATTCAGGAAACCACGAGAGCCAAGCTGTGGGTAGCCGAGGCTCTGGTGACTCCTGAG
CTTGGGCTACGCCGTGACATACCAAGCTGCGAATTGGACGGCTCCTTGGGAGACTCGACAGGCCACCGGGCTGCC
AACACGCCAGAGTCCGCAGGCGTACCAAGCCGTGGAAGCTCAACGACACCTCAGGTGCGGGTTACGTTGACCGGC
CCCACTACATCGGGCAAGTCGAGTTTGCTCGGGACGCTGTCCACCGGAACATTGGACAACGGCCGAGGAAAGAGT
CGTCTCAGTCTGCTGAAGCACCGGCATGAGATGATTTCTGGCGTGACGAGCTCCATTGCGCAGGAGCTTGTCGGA
TACAAAGATAGAGAGATCCTCAATTACTCTCGGGGAAACATAGAGTCGTGGCTCGACATCCACGACTGCGCCGAG
AACGGCAGGCTGGTTTTCGTGTCCGATTCTGGGGGACACCCTCGCTATCGCCGCACCGTGCTCCGTGGACTCATG
AGCTGGGCACCGCATTGGAGCATCCTGTGTATCGCAGCAGACGCCACCGACGAAGTGACGGGAGCGGTCGACTCG
GCATCTTCGGCGCAGGAGGTGCCGGCCGCGGCCGCGGTGGGGGTTGATCTCGTCAAAGCACACCTGACGCTGTCG
CTCAAGCTTGACGTACCCATGGCAATCGTCATCACGAAGCTCGACCTGGCGTCCAAGTTCAGCCTTCACAAGACA
ATGACCAAGGTCTTGACTGCCATCAAAGAGGCAGGCCGGATGCCCAAAATCCTCCAGCCTGATCAGCGGCAGCAC
GATGGGCTCAAATACATACCACCCGAGGATCAGGCCAAAGTCGGATCCGTCATCGACGGAATGATGGAAGTCGAG
AGCCAAATCGCACAGGTACCCATTGTGCTGACGAGCGCGGTCAAGGGCACGGGCATCGGACTAGTCCACGCCCTG
CTTGCGAGCTTGCCACTGCCTCCGGCGCCACCGCCGACGGATGGTATCGGGACGGCGTCGAGTCCAGAGCAGCCC
GAGTGCTTATTTCCCATCGACGATACTTTTAGCCTTCCAAGCTCGTACCGCTTCCCGACGCCTGTCTTGGGACGA
CGTGCGGCCAGGGGCGTCATCGTATCGGGGTATGTTCGGTGCGGAAGCTTGTCTGTCGGCGACAGGGTCGTGGTT
GGTCCATTCCAGCCTTCTGCGGACGATGAGGCTCGTGTTCTGCCGATGGCCATGGGATATGGGTCGTCGCCGGGA
AGCTACGGACTGTCAATATCACACCCGTCGTCCGCAGAACTGGCTCGGATTGCGGTCAAGAATGCGATCTCGGCA
TCCACGACCGTGGGAGAATGGAATGTGGCACAGATCGTCAGCATACGCAATCTGCGGTTGCCTGTGCGCGCTCTT
GAGGCTGGCCAAGCTGGATCAATCGGACTTGTTTTCGAGCTGTATACCGAACATGCCGACAACATCGACGACCCA
CCCCGAATACGCCGAGGCATGGTGTTGGCATTGCTCTCGAAGCCCACCATGAATGGCGGCCCGTCACTCCAGGCT
GCCAGCGGGTTTACGGCGACGTTCCGCGACTCGGGGATCCGGCTCCTGACCCGCGGGTCGCTCGTCAACGTGTAC
TTCGCCAGCGTGCGGGCGGCGGCCCGAATCCTGCGCGTGTCTTGCCATCAAGTCGGTGGCTGCTCGGGGGCATCG
GCGACAGCTGACCTCGACGACATACTCCGCCTGACTGAAGACCTCGGCGACCTGCACAGCCAAGAGTTTCGCGGA
GAGGTCACCCTAGAACTACTTCACAACCGAGAGTGGGTTGAGGTGGGTTCCCGAGTCTTGCTGCTTGAGGGCGGG
AGTCAAGACAAGTCAGGACTGGAGGGCTACGTCGGCGAAGTTGTCGAAATTGTGGAATGA
Transcript >Hirsu2|1572
ATGGCATCAATCTTCACTTACGATCCGGATCCCCCGCGCGTATCTTCCCCCTGGCTCGCGTCCGACAATGCTGCC
AGCCAGGCGCCCGACCGCTCTCCTGCCCCAAGCTCCGAATCCGACGGCGCTGTCACCAAGCTTCAGGCAGAGCCT
CAGAGGGGGCCTACCGAGTACAAGCTTCATCTCTTGCTCCGGCCCCGGCGAGTGTACACGTTCATGAGCACGACT
GGACTGGCCGGTGCGCCTTCGCAACCGGGATCGCAGGAAACAGCCCCCCTGAAGACGGCGCCTGCTGTCCCGGCA
GCATCCAGTCAGCCTCAACGTGAAAGACTCAAGCATCTCACTACTCAGCTCCTGTGGAGGCTACAGCAATCTTCT
CCCTACCATGCCTCGAGCTCGAAAGAGCTCACTGTACCGAAGCTGCCGGCTGGCAGCTTCGACCTCGACGTGCCC
GTCAAATTGGAGGCGCTGGTGCCCGGGCTTGAAGAGTCGCGAGGGGCGTTGTACGAGATTGGTGTTTCCGACGAC
GGCTCCCTCATTGGCCTAACCAAGGACGAGATGAGCGAGAGTATTGCAACACTGCGCGTCATGGCTGCTAGTCTG
GGCTGCCTCGTGGACGTCGTTCGTACGGTCATCGTTGGAGAGTGCGCCTGGGTTGAGCCGCAAGGGCTGGCCGAC
GCTGCGAGCTCCGCGCCGATTCAGGAAACCACGAGAGCCAAGCTGTGGGTAGCCGAGGCTCTGGTGACTCCTGAG
CTTGGGCTACGCCGTGACATACCAAGCTGCGAATTGGACGGCTCCTTGGGAGACTCGACAGGCCACCGGGCTGCC
AACACGCCAGAGTCCGCAGGCGTACCAAGCCGTGGAAGCTCAACGACACCTCAGGTGCGGGTTACGTTGACCGGC
CCCACTACATCGGGCAAGTCGAGTTTGCTCGGGACGCTGTCCACCGGAACATTGGACAACGGCCGAGGAAAGAGT
CGTCTCAGTCTGCTGAAGCACCGGCATGAGATGATTTCTGGCGTGACGAGCTCCATTGCGCAGGAGCTTGTCGGA
TACAAAGATAGAGAGATCCTCAATTACTCTCGGGGAAACATAGAGTCGTGGCTCGACATCCACGACTGCGCCGAG
AACGGCAGGCTGGTTTTCGTGTCCGATTCTGGGGGACACCCTCGCTATCGCCGCACCGTGCTCCGTGGACTCATG
AGCTGGGCACCGCATTGGAGCATCCTGTGTATCGCAGCAGACGCCACCGACGAAGTGACGGGAGCGGTCGACTCG
GCATCTTCGGCGCAGGAGGTGCCGGCCGCGGCCGCGGTGGGGGTTGATCTCGTCAAAGCACACCTGACGCTGTCG
CTCAAGCTTGACGTACCCATGGCAATCGTCATCACGAAGCTCGACCTGGCGTCCAAGTTCAGCCTTCACAAGACA
ATGACCAAGGTCTTGACTGCCATCAAAGAGGCAGGCCGGATGCCCAAAATCCTCCAGCCTGATCAGCGGCAGCAC
GATGGGCTCAAATACATACCACCCGAGGATCAGGCCAAAGTCGGATCCGTCATCGACGGAATGATGGAAGTCGAG
AGCCAAATCGCACAGGTACCCATTGTGCTGACGAGCGCGGTCAAGGGCACGGGCATCGGACTAGTCCACGCCCTG
CTTGCGAGCTTGCCACTGCCTCCGGCGCCACCGCCGACGGATGGTATCGGGACGGCGTCGAGTCCAGAGCAGCCC
GAGTGCTTATTTCCCATCGACGATACTTTTAGCCTTCCAAGCTCGTACCGCTTCCCGACGCCTGTCTTGGGACGA
CGTGCGGCCAGGGGCGTCATCGTATCGGGGTATGTTCGGTGCGGAAGCTTGTCTGTCGGCGACAGGGTCGTGGTT
GGTCCATTCCAGCCTTCTGCGGACGATGAGGCTCGTGTTCTGCCGATGGCCATGGGATATGGGTCGTCGCCGGGA
AGCTACGGACTGTCAATATCACACCCGTCGTCCGCAGAACTGGCTCGGATTGCGGTCAAGAATGCGATCTCGGCA
TCCACGACCGTGGGAGAATGGAATGTGGCACAGATCGTCAGCATACGCAATCTGCGGTTGCCTGTGCGCGCTCTT
GAGGCTGGCCAAGCTGGATCAATCGGACTTGTTTTCGAGCTGTATACCGAACATGCCGACAACATCGACGACCCA
CCCCGAATACGCCGAGGCATGGTGTTGGCATTGCTCTCGAAGCCCACCATGAATGGCGGCCCGTCACTCCAGGCT
GCCAGCGGGTTTACGGCGACGTTCCGCGACTCGGGGATCCGGCTCCTGACCCGCGGGTCGCTCGTCAACGTGTAC
TTCGCCAGCGTGCGGGCGGCGGCCCGAATCCTGCGCGTGTCTTGCCATCAAGTCGGTGGCTGCTCGGGGGCATCG
GCGACAGCTGACCTCGACGACATACTCCGCCTGACTGAAGACCTCGGCGACCTGCACAGCCAAGAGTTTCGCGGA
GAGGTCACCCTAGAACTACTTCACAACCGAGAGTGGGTTGAGGTGGGTTCCCGAGTCTTGCTGCTTGAGGGCGGG
AGTCAAGACAAGTCAGGACTGGAGGGCTACGTCGGCGAAGTTGTCGAAATTGTGGAATGA
Gene >Hirsu2|1572
ATGGCATCAATCTTCACTTACGATCCGGATCCCCCGCGCGTATCTTCCCCCTGGCTCGCGTCCGACAATGCTGCC
AGCCAGGCGCCCGACCGCTCTCCTGCCCCAAGCTCCGAATCCGACGGCGCTGTCACCAAGCTTCAGGCAGAGCCT
CAGAGGGGGCCTACCGAGTACAAGCTTCATCTCTTGCTCCGGCCCCGGCGAGTGTACACGTTCATGAGCACGACT
GGACTGGCCGGTGCGCCTTCGCAACCGGGATCGCAGGAAACAGCCCCCCTGAAGACGGCGCCTGCTGTCCCGGCA
GCATCCAGTCAGCCTCAACGTGAAAGACTCAAGCATCTCACTACTCAGCTCCTGTGGAGGCTACAGCAATCTTCT
CCCTACCATGCCTCGAGCTCGAAAGAGCTCACTGTACCGAAGCTGCCGGCTGGCAGCTTCGACCTCGACGTGCCC
GTCAAATTGGAGGCGCTGGTGCCCGGGCTTGAAGAGTCGCGAGGGGCGTTGTACGAGATTGGTGTTTCCGACGAC
GGCTCCCTCATTGGCCTAACCAAGGACGAGATGAGCGAGAGTATTGCAACACTGCGCGTCATGGCTGCTAGTCTG
GGCTGCCTCGTGGACGTCGTTCGTACGGTCATCGTTGGAGAGTGCGCCTGGGTTGAGCCGCAAGGGCTGGCCGAC
GCTGCGAGCTCCGCGCCGATTCAGGAAACCACGAGAGCCAAGCTGTGGGTAGCCGAGGCTCTGGTGACTCCTGAG
CTTGGGCTACGCCGTGACATACCAAGCTGCGAATTGGACGGCTCCTTGGGAGACTCGACAGGCCACCGGGCTGCC
AACACGCCAGAGTCCGCAGGCGTACCAAGCCGTGGAAGCTCAACGACACCTCAGGTGCGGGTTACGTTGACCGGC
CCCACTACATCGGGCAAGTCGAGTTTGCTCGGGACGCTGTCCACCGGAACATTGGACAACGGCCGAGGAAAGAGT
CGTCTCAGTCTGCTGAAGCACCGGCATGAGATGATTTCTGGCGTGACGAGCTCCATTGCGCAGGAGCTTGTCGGA
TACAAAGATAGAGAGATCCTCAATTACTCTCGGGGAAACATAGAGTCGTGGCTCGACATCCACGACTGCGCCGAG
AACGGCAGGCTGGTTTTCGTGTCCGATTCTGGGGGACACCCTCGCTATCGCCGCACCGTGCTCCGTGGACTCATG
AGCTGGGCACCGCATTGGAGCATCCTGTGTATCGCAGCAGACGCCACCGACGAAGTGACGGGAGCGGTCGACTCG
GCATCTTCGGCGCAGGAGGTGCCGGCCGCGGCCGCGGTGGGGGTTGATCTCGTCAAAGCACACCTGACGCTGTCG
CTCAAGCTTGACGTACCCATGGCAATCGTCATCACGAAGCTCGACCTGGCGTCCAAGTTCAGCCTTCACAAGACA
ATGACCAAGGTCTTGACTGCCATCAAAGAGGCAGGCCGGATGCCCAAAATCCTCCAGCCTGATCAGCGGCAGCAC
GATGGGCTCAAATACATACCACCCGAGGATCAGGCCAAAGTCGGATCCGTCATCGACGGAATGATGGAAGTCGAG
AGCCAAATCGCACAGGTACCCATTGTGCTGACGAGCGCGGTCAAGGGCACGGGCATCGGACTAGTCCACGCCCTG
CTTGCGAGCTTGCCACTGCCTCCGGCGCCACCGCCGACGGATGGTATCGGGACGGCGTCGAGTCCAGAGCAGCCC
GAGTGCTTATTTCCCATCGACGATACTTTTAGCCTTCCAAGCTCGTACCGCTTCCCGACGCCTGTCTTGGGACGA
CGTGCGGCCAGGGGCGTCATCGTATCGGGGTATGTTCGGTGCGGAAGCTTGTCTGTCGGCGACAGGGTCGTGGTT
GGTCCATTCCAGCCTTCTGCGGACGATGAGGCTCGTGTTCTGCCGATGGCCATGGGATATGGGTCGTCGCCGGGA
AGCTACGGACTGTCAATATCACACCCGTCGTCCGCAGAACTGGCTCGGATTGCGGTCAAGAATGCGATCTCGGCA
TCCACGACCGTGGGAGAATGGAATGTGGCACAGATCGTCAGCATACGCAATCTGCGGTTGCCTGTGCGCGCTCTT
GAGGCTGGCCAAGCTGGATCAATCGGACTTGTTTTCGAGCTGTATACCGAACATGCCGACAACATCGACGACCCA
CCCCGAATACGCCGAGGCATGGTGTTGGCATTGCTCTCGAAGCCCACCATGAATGGCGGCCCGTCACTCCAGGCT
GCCAGCGGGTTTACGGCGACGTTCCGCGACTCGGGGATCCGGCTCCTGACCCGCGGGTCGCTCGTCAACGTGTAC
TTCGCCAGCGTGCGGGCGGCGGCCCGAATCCTGCGCGTGTCTTGCCATCAAGTCGGTGGCTGCTCGGGGGCATCG
GCGACAGCTGACCTCGACGACATACTCCGCCTGACTGAAGACCTCGGCGACCTGCACAGCCAAGAGTTTCGCGGA
GAGGTCACCCTAGAACTACTTCACAACCGAGAGTGGGTTGAGGTGGGTTCCCGAGTCTTGCTGCTTGAGGGCGGG
AGTCAAGACAAGTCAGGACTGGAGGGCTACGTCGGCGAAGTTGTCGAAATTGTGGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail