Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1571
Gene name
LocationContig_135:24394..24823
Strand+
Gene length (bp)429
Transcript length (bp)357
Coding sequence length (bp)357
Protein length (aa) 119

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07019 Rab5ip Rab5-interacting protein (Rab5ip) 1.1E-29 23 113

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59764|YJMB_SCHPO ER membrane protein complex subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.11c PE=3 SV=2 4 116 2.0E-15
sp|Q3ZCG8|EMC6_BOVIN ER membrane protein complex subunit 6 OS=Bos taurus GN=EMC6 PE=3 SV=1 11 116 6.0E-09
sp|Q9CQW0|EMC6_MOUSE ER membrane protein complex subunit 6 OS=Mus musculus GN=Emc6 PE=1 SV=1 11 116 2.0E-08
sp|Q9BV81|EMC6_HUMAN ER membrane protein complex subunit 6 OS=Homo sapiens GN=EMC6 PE=1 SV=1 11 116 2.0E-08
sp|Q68EU8|EMC6_XENLA ER membrane protein complex subunit 6 OS=Xenopus laevis GN=emc6 PE=3 SV=1 12 116 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59764|YJMB_SCHPO ER membrane protein complex subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.11c PE=3 SV=2 4 116 2.0E-15
sp|Q3ZCG8|EMC6_BOVIN ER membrane protein complex subunit 6 OS=Bos taurus GN=EMC6 PE=3 SV=1 11 116 6.0E-09
sp|Q9CQW0|EMC6_MOUSE ER membrane protein complex subunit 6 OS=Mus musculus GN=Emc6 PE=1 SV=1 11 116 2.0E-08
sp|Q9BV81|EMC6_HUMAN ER membrane protein complex subunit 6 OS=Homo sapiens GN=EMC6 PE=1 SV=1 11 116 2.0E-08
sp|Q68EU8|EMC6_XENLA ER membrane protein complex subunit 6 OS=Xenopus laevis GN=emc6 PE=3 SV=1 12 116 2.0E-08
sp|Q6GLC5|EMC6_XENTR ER membrane protein complex subunit 6 OS=Xenopus tropicalis GN=emc6 PE=3 SV=1 12 116 4.0E-08
sp|Q12431|EMC6_YEAST ER membrane protein complex subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMC6 PE=1 SV=1 16 116 8.0E-07
sp|Q6P0F0|EMC6_DANRE ER membrane protein complex subunit 6 OS=Danio rerio GN=emc6 PE=3 SV=1 12 116 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 50 67 17
2 94 116 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1571
MLSERDYQLRPVVQDSVIHNSKTLSNLHSIVASLLGVSAGILGLESYHGFLFYLALSTLTTLLFYAIKVAPESRA
EKRSVFDTGRYFHSAMDFWTGGIFGGLSGFVLTWTLFYGLVRA*
Coding >Hirsu2|1571
ATGCTCTCCGAACGCGATTACCAGCTCCGTCCCGTGGTCCAGGACTCTGTCATACACAATTCCAAGACCCTGTCC
AATCTCCACAGCATCGTCGCCTCCCTTCTCGGCGTCAGCGCTGGCATCCTCGGCCTCGAGTCCTACCACGGCTTC
CTCTTCTATCTGGCCCTGTCCACCCTGACCACCCTCCTCTTCTACGCGATCAAGGTGGCGCCCGAGTCGCGGGCC
GAGAAACGGTCCGTTTTCGACACGGGTCGCTACTTCCACTCCGCCATGGACTTCTGGACTGGCGGCATATTCGGA
GGCCTGTCTGGATTTGTCTTGACCTGGACATTGTTCTACGGCTTGGTGAGGGCCTAG
Transcript >Hirsu2|1571
ATGCTCTCCGAACGCGATTACCAGCTCCGTCCCGTGGTCCAGGACTCTGTCATACACAATTCCAAGACCCTGTCC
AATCTCCACAGCATCGTCGCCTCCCTTCTCGGCGTCAGCGCTGGCATCCTCGGCCTCGAGTCCTACCACGGCTTC
CTCTTCTATCTGGCCCTGTCCACCCTGACCACCCTCCTCTTCTACGCGATCAAGGTGGCGCCCGAGTCGCGGGCC
GAGAAACGGTCCGTTTTCGACACGGGTCGCTACTTCCACTCCGCCATGGACTTCTGGACTGGCGGCATATTCGGA
GGCCTGTCTGGATTTGTCTTGACCTGGACATTGTTCTACGGCTTGGTGAGGGCCTAG
Gene >Hirsu2|1571
ATGCTCTCCGAACGCGATTACCAGCTCCGTCCCGTGGTCCAGGACTCTGTCATACACAATTCCAAGGTACGGCCC
TCCTCGGCCCGCGTCCACGGGAGATGCTTCGCGATGCTGATGCGCGGCTCCGCCTGCACGCAGACCCTGTCCAAT
CTCCACAGCATCGTCGCCTCCCTTCTCGGCGTCAGCGCTGGCATCCTCGGCCTCGAGTCCTACCACGGCTTCCTC
TTCTATCTGGCCCTGTCCACCCTGACCACCCTCCTCTTCTACGCGATCAAGGTGGCGCCCGAGTCGCGGGCCGAG
AAACGGTCCGTTTTCGACACGGGTCGCTACTTCCACTCCGCCATGGACTTCTGGACTGGCGGCATATTCGGAGGC
CTGTCTGGATTTGTCTTGACCTGGACATTGTTCTACGGCTTGGTGAGGGCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail