Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1560
Gene name
LocationContig_135:4520..6648
Strand+
Gene length (bp)2128
Transcript length (bp)1830
Coding sequence length (bp)1830
Protein length (aa) 610

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00520 Ion_trans Ion transport protein 9.3E-11 8 89
PF00520 Ion_trans Ion transport protein 7.2E-25 140 389

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14234|CCH1_SCHPO Calcium-channel protein cch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cch1 PE=3 SV=1 3 600 4.0E-127
sp|P50077|CCH1_YEAST Calcium-channel protein CCH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCH1 PE=1 SV=1 1 581 8.0E-94
sp|Q6Q760|NALCN_RAT Sodium leak channel non-selective protein OS=Rattus norvegicus GN=Nalcn PE=1 SV=1 3 418 1.0E-36
sp|Q8IZF0|NALCN_HUMAN Sodium leak channel non-selective protein OS=Homo sapiens GN=NALCN PE=1 SV=1 3 418 1.0E-36
sp|Q8BXR5|NALCN_MOUSE Sodium leak channel non-selective protein OS=Mus musculus GN=Nalcn PE=1 SV=2 3 418 1.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14234|CCH1_SCHPO Calcium-channel protein cch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cch1 PE=3 SV=1 3 600 4.0E-127
sp|P50077|CCH1_YEAST Calcium-channel protein CCH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCH1 PE=1 SV=1 1 581 8.0E-94
sp|Q6Q760|NALCN_RAT Sodium leak channel non-selective protein OS=Rattus norvegicus GN=Nalcn PE=1 SV=1 3 418 1.0E-36
sp|Q8IZF0|NALCN_HUMAN Sodium leak channel non-selective protein OS=Homo sapiens GN=NALCN PE=1 SV=1 3 418 1.0E-36
sp|Q8BXR5|NALCN_MOUSE Sodium leak channel non-selective protein OS=Mus musculus GN=Nalcn PE=1 SV=2 3 418 1.0E-36
sp|Q15858|SCN9A_HUMAN Sodium channel protein type 9 subunit alpha OS=Homo sapiens GN=SCN9A PE=1 SV=3 13 418 2.0E-30
sp|O08562|SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus GN=Scn9a PE=1 SV=1 13 418 2.0E-29
sp|Q28644|SCN9A_RABIT Sodium channel protein type 9 subunit alpha OS=Oryctolagus cuniculus GN=SCN9A PE=2 SV=1 13 418 2.0E-29
sp|Q62205|SCN9A_MOUSE Sodium channel protein type 9 subunit alpha OS=Mus musculus GN=Scn9a PE=1 SV=2 13 418 4.0E-28
sp|P08104|SCN3A_RAT Sodium channel protein type 3 subunit alpha OS=Rattus norvegicus GN=Scn3a PE=1 SV=1 9 418 1.0E-27
sp|P35498|SCN1A_HUMAN Sodium channel protein type 1 subunit alpha OS=Homo sapiens GN=SCN1A PE=1 SV=2 9 430 2.0E-27
sp|P04774|SCN1A_RAT Sodium channel protein type 1 subunit alpha OS=Rattus norvegicus GN=Scn1a PE=1 SV=1 9 430 2.0E-27
sp|O46669|SCNAA_CANLF Sodium channel protein type 10 subunit alpha OS=Canis lupus familiaris GN=SCN10A PE=2 SV=1 13 445 3.0E-27
sp|Q99250|SCN2A_HUMAN Sodium channel protein type 2 subunit alpha OS=Homo sapiens GN=SCN2A PE=1 SV=3 9 418 5.0E-27
sp|Q9NY46|SCN3A_HUMAN Sodium channel protein type 3 subunit alpha OS=Homo sapiens GN=SCN3A PE=1 SV=2 9 418 1.0E-26
sp|P04775|SCN2A_RAT Sodium channel protein type 2 subunit alpha OS=Rattus norvegicus GN=Scn2a PE=1 SV=1 9 418 1.0E-26
sp|Q9W0Y8|SCN60_DROME Sodium channel protein 60E OS=Drosophila melanogaster GN=NaCP60E PE=2 SV=5 9 418 2.0E-26
sp|Q14524|SCN5A_HUMAN Sodium channel protein type 5 subunit alpha OS=Homo sapiens GN=SCN5A PE=1 SV=2 13 418 4.0E-26
sp|Q9WTU3|SCN8A_MOUSE Sodium channel protein type 8 subunit alpha OS=Mus musculus GN=Scn8a PE=1 SV=1 9 418 5.0E-26
sp|Q9UQD0|SCN8A_HUMAN Sodium channel protein type 8 subunit alpha OS=Homo sapiens GN=SCN8A PE=1 SV=1 9 418 5.0E-26
sp|O88420|SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus GN=Scn8a PE=1 SV=1 9 418 6.0E-26
sp|Q9JJV9|SCN5A_MOUSE Sodium channel protein type 5 subunit alpha OS=Mus musculus GN=Scn5a PE=1 SV=2 13 418 1.0E-25
sp|P15389|SCN5A_RAT Sodium channel protein type 5 subunit alpha OS=Rattus norvegicus GN=Scn5a PE=1 SV=1 13 418 1.0E-25
sp|Q9R053|SCNBA_MOUSE Sodium channel protein type 11 subunit alpha OS=Mus musculus GN=Scn11a PE=2 SV=2 10 423 2.0E-25
sp|Q2XVR5|SC4AA_TETNG Sodium channel protein type 4 subunit alpha A OS=Tetraodon nigroviridis GN=scn4aa PE=3 SV=2 9 418 5.0E-25
sp|Q6QIY3|SCNAA_MOUSE Sodium channel protein type 10 subunit alpha OS=Mus musculus GN=Scn10a PE=1 SV=2 9 445 8.0E-25
sp|P91645|CAC1A_DROME Voltage-dependent calcium channel type A subunit alpha-1 OS=Drosophila melanogaster GN=cac PE=1 SV=3 12 418 2.0E-24
sp|Q05973|SCN1_HETBL Sodium channel protein 1 brain OS=Heterololigo bleekeri PE=2 SV=1 9 443 5.0E-24
sp|Q9Y5Y9|SCNAA_HUMAN Sodium channel protein type 10 subunit alpha OS=Homo sapiens GN=SCN10A PE=1 SV=2 9 445 6.0E-24
sp|P0DMA5|SCNAA_ONYTO Sodium channel protein type 10 subunit alpha OS=Onychomys torridus GN=Scn10a PE=1 SV=1 9 445 8.0E-24
sp|C9D7C2|CAC1A_APIME Voltage-dependent calcium channel type A subunit alpha-1 OS=Apis mellifera GN=CAC PE=2 SV=1 11 418 1.0E-23
sp|P15390|SCN4A_RAT Sodium channel protein type 4 subunit alpha OS=Rattus norvegicus GN=Scn4a PE=1 SV=1 13 418 2.0E-23
sp|O88457|SCNBA_RAT Sodium channel protein type 11 subunit alpha OS=Rattus norvegicus GN=Scn11a PE=1 SV=1 10 418 2.0E-23
sp|P35500|SCNA_DROME Sodium channel protein para OS=Drosophila melanogaster GN=para PE=2 SV=3 9 441 2.0E-23
sp|Q9ER60|SCN4A_MOUSE Sodium channel protein type 4 subunit alpha OS=Mus musculus GN=Scn4a PE=2 SV=1 9 418 3.0E-23
sp|Q20JQ7|SC4AB_DANRE Sodium channel protein type 4 subunit alpha B OS=Danio rerio GN=scn4ab PE=2 SV=1 9 442 2.0E-22
sp|Q2XVR6|SC4AB_TAKRU Sodium channel protein type 4 subunit alpha B OS=Takifugu rubripes GN=scn4ab PE=3 SV=1 9 441 3.0E-22
sp|Q9UI33|SCNBA_HUMAN Sodium channel protein type 11 subunit alpha OS=Homo sapiens GN=SCN11A PE=1 SV=2 9 418 6.0E-22
sp|P02719|SCNA_ELEEL Sodium channel protein OS=Electrophorus electricus PE=2 SV=1 13 441 9.0E-22
sp|Q2XVR7|SC4AA_TAKRU Sodium channel protein type 4 subunit alpha A OS=Takifugu rubripes GN=scn4aa PE=3 SV=1 9 418 1.0E-21
sp|Q62968|SCNAA_RAT Sodium channel protein type 10 subunit alpha OS=Rattus norvegicus GN=Scn10a PE=1 SV=1 9 445 1.0E-21
sp|O57483|CAC1S_LITCT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Lithobates catesbeiana PE=2 SV=1 4 418 2.0E-21
sp|P35499|SCN4A_HUMAN Sodium channel protein type 4 subunit alpha OS=Homo sapiens GN=SCN4A PE=1 SV=4 13 419 5.0E-21
sp|Q2XVR4|SC4AB_TETNG Sodium channel protein type 4 subunit alpha B OS=Tetraodon nigroviridis GN=scn4ab PE=3 SV=1 13 418 4.0E-20
sp|Q28371|SCN4A_HORSE Sodium channel protein type 4 subunit alpha OS=Equus caballus GN=SCN4A PE=1 SV=1 9 418 4.0E-19
sp|Q05152|CAC1B_RABIT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Oryctolagus cuniculus GN=CACNA1B PE=1 SV=1 12 431 1.0E-18
sp|Q00975|CAC1B_HUMAN Voltage-dependent N-type calcium channel subunit alpha-1B OS=Homo sapiens GN=CACNA1B PE=1 SV=1 12 431 4.0E-18
sp|Q2XVR3|SC4AA_DANRE Sodium channel protein type 4 subunit alpha A OS=Danio rerio GN=scn4aa PE=2 SV=2 9 418 1.0E-17
sp|O55017|CAC1B_MOUSE Voltage-dependent N-type calcium channel subunit alpha-1B OS=Mus musculus GN=Cacna1b PE=1 SV=1 12 431 1.0E-17
sp|P15381|CAC1C_RABIT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Oryctolagus cuniculus GN=CACNA1C PE=1 SV=1 1 418 4.0E-17
sp|Q25452|CAC1M_MUSDO Muscle calcium channel subunit alpha-1 OS=Musca domestica PE=2 SV=1 2 431 6.0E-17
sp|Q01815|CAC1C_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1C OS=Mus musculus GN=Cacna1c PE=1 SV=1 1 418 6.0E-17
sp|Q02294|CAC1B_RAT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Rattus norvegicus GN=Cacna1b PE=1 SV=1 12 431 7.0E-17
sp|P27732|CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus GN=Cacna1d PE=1 SV=2 5 418 7.0E-17
sp|Q02343|CAC1E_RABIT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Oryctolagus cuniculus GN=CACNA1E PE=2 SV=1 144 418 4.0E-16
sp|Q9EQ60|CAC1H_RAT Voltage-dependent T-type calcium channel subunit alpha-1H OS=Rattus norvegicus GN=Cacna1h PE=2 SV=2 12 329 5.0E-16
sp|P97445|CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus GN=Cacna1a PE=1 SV=2 12 418 5.0E-16
sp|P22002|CAC1C_RAT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Rattus norvegicus GN=Cacna1c PE=1 SV=1 1 418 5.0E-16
sp|Q24270|CAC1D_DROME Voltage-dependent calcium channel type D subunit alpha-1 OS=Drosophila melanogaster GN=Ca-alpha1D PE=1 SV=2 8 431 8.0E-16
sp|Q99246|CAC1D_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1D OS=Mus musculus GN=Cacna1d PE=1 SV=3 5 418 9.0E-16
sp|O73700|CAC1D_CHICK Voltage-dependent L-type calcium channel subunit alpha-1D OS=Gallus gallus GN=CACNA1D PE=2 SV=1 1 418 1.0E-15
sp|P56698|CAC1B_DIPOM Probable voltage-dependent N-type calcium channel subunit alpha-1B OS=Diplobatis ommata PE=2 SV=1 4 419 1.0E-15
sp|Q15878|CAC1E_HUMAN Voltage-dependent R-type calcium channel subunit alpha-1E OS=Homo sapiens GN=CACNA1E PE=1 SV=3 144 418 2.0E-15
sp|Q01668|CAC1D_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1D OS=Homo sapiens GN=CACNA1D PE=1 SV=2 5 418 2.0E-15
sp|O88427|CAC1H_MOUSE Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus GN=Cacna1h PE=1 SV=3 12 329 2.0E-15
sp|P54282|CAC1A_RAT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Rattus norvegicus GN=Cacna1a PE=1 SV=1 12 418 2.0E-15
sp|O95180|CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens GN=CACNA1H PE=1 SV=4 12 329 2.0E-15
sp|Q07652|CAC1E_RAT Voltage-dependent R-type calcium channel subunit alpha-1E OS=Rattus norvegicus GN=Cacna1e PE=1 SV=1 144 418 4.0E-15
sp|Q61290|CAC1E_MOUSE Voltage-dependent R-type calcium channel subunit alpha-1E OS=Mus musculus GN=Cacna1e PE=1 SV=1 144 418 6.0E-15
sp|Q9JIS7|CAC1F_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1F OS=Mus musculus GN=Cacna1f PE=1 SV=1 5 418 1.0E-14
sp|P27884|CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus GN=CACNA1A PE=1 SV=1 12 416 1.0E-14
sp|O54898|CAC1G_RAT Voltage-dependent T-type calcium channel subunit alpha-1G OS=Rattus norvegicus GN=Cacna1g PE=1 SV=2 12 380 1.0E-14
sp|P22316|CAC1S_CYPCA Dihydropyridine-sensitive L-type skeletal muscle calcium channel subunit alpha-1 OS=Cyprinus carpio PE=2 SV=1 5 418 2.0E-14
sp|Q99244|CAC1D_MESAU Voltage-dependent L-type calcium channel subunit alpha-1D OS=Mesocricetus auratus GN=CACNA1D PE=2 SV=2 5 418 2.0E-14
sp|O00555|CAC1A_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Homo sapiens GN=CACNA1A PE=1 SV=2 12 416 3.0E-14
sp|P56699|CAC1E_DIPOM Probable voltage-dependent R-type calcium channel subunit alpha-1E OS=Diplobatis ommata PE=2 SV=1 12 418 3.0E-14
sp|Q13936|CAC1C_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1C OS=Homo sapiens GN=CACNA1C PE=1 SV=4 1 418 1.0E-13
sp|O60840|CAC1F_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1F OS=Homo sapiens GN=CACNA1F PE=1 SV=2 9 418 1.0E-13
sp|Q13698|CAC1S_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1S OS=Homo sapiens GN=CACNA1S PE=1 SV=4 12 418 5.0E-13
sp|Q9P0X4|CAC1I_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1I OS=Homo sapiens GN=CACNA1I PE=1 SV=1 12 378 6.0E-13
sp|P07293|CAC1S_RABIT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Oryctolagus cuniculus GN=CACNA1S PE=1 SV=1 2 418 6.0E-13
sp|Q02789|CAC1S_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1S OS=Mus musculus GN=Cacna1s PE=1 SV=2 2 418 1.0E-12
sp|Q02485|CAC1S_RAT Voltage-dependent L-type calcium channel subunit alpha-1S (Fragment) OS=Rattus norvegicus GN=Cacna1s PE=1 SV=1 2 418 2.0E-12
sp|Q9Z0Y8|CAC1I_RAT Voltage-dependent T-type calcium channel subunit alpha-1I OS=Rattus norvegicus GN=Cacna1i PE=1 SV=3 12 378 2.0E-12
sp|Q24270|CAC1D_DROME Voltage-dependent calcium channel type D subunit alpha-1 OS=Drosophila melanogaster GN=Ca-alpha1D PE=1 SV=2 13 383 5.0E-12
sp|Q25452|CAC1M_MUSDO Muscle calcium channel subunit alpha-1 OS=Musca domestica PE=2 SV=1 13 329 6.0E-11
sp|Q13698|CAC1S_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1S OS=Homo sapiens GN=CACNA1S PE=1 SV=4 14 402 9.0E-11
sp|O54898|CAC1G_RAT Voltage-dependent T-type calcium channel subunit alpha-1G OS=Rattus norvegicus GN=Cacna1g PE=1 SV=2 129 388 1.0E-10
sp|O43497|CAC1G_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1G OS=Homo sapiens GN=CACNA1G PE=2 SV=3 129 388 2.0E-10
sp|Q01118|SCN7A_HUMAN Sodium channel protein type 7 subunit alpha OS=Homo sapiens GN=SCN7A PE=1 SV=2 9 418 2.0E-09
sp|Q02789|CAC1S_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1S OS=Mus musculus GN=Cacna1s PE=1 SV=2 14 327 3.0E-09
sp|P07293|CAC1S_RABIT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Oryctolagus cuniculus GN=CACNA1S PE=1 SV=1 14 327 1.0E-08
sp|O73707|CAC1C_CHICK Voltage-dependent L-type calcium channel subunit alpha-1C (Fragment) OS=Gallus gallus GN=CACNA1C PE=2 SV=1 246 378 5.0E-08
sp|O95180|CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens GN=CACNA1H PE=1 SV=4 73 387 8.0E-08
sp|O73706|CAC1B_CHICK Voltage-dependent N-type calcium channel subunit alpha-1B (Fragment) OS=Gallus gallus GN=CACNA1B PE=2 SV=1 278 378 4.0E-07
sp|O43497|CAC1G_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1G OS=Homo sapiens GN=CACNA1G PE=2 SV=3 144 380 6.0E-07
sp|O73705|CAC1A_CHICK Voltage-dependent P/Q-type calcium channel subunit alpha-1A (Fragment) OS=Gallus gallus GN=CACNA1A PE=2 SV=1 303 378 8.0E-07
sp|Q9EQ60|CAC1H_RAT Voltage-dependent T-type calcium channel subunit alpha-1H OS=Rattus norvegicus GN=Cacna1h PE=2 SV=2 139 388 4.0E-06
sp|O42398|CAC1S_CHICK Voltage-dependent L-type calcium channel subunit alpha-1S (Fragment) OS=Gallus gallus GN=CACNA1S PE=2 SV=1 177 329 4.0E-06
sp|O88427|CAC1H_MOUSE Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus GN=Cacna1h PE=1 SV=3 97 388 5.0E-06
sp|O43497|CAC1G_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1G OS=Homo sapiens GN=CACNA1G PE=2 SV=3 12 85 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005216 ion channel activity Yes
GO:0006811 ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0015267 channel activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022803 passive transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0022838 substrate-specific channel activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

Domain # Start End Length
1 59 81 22
2 140 157 17
3 172 194 22
4 201 223 22
5 261 283 22
6 357 379 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1560
MLAPRVASNPYFDFDDFGSSLFTLFQIVSQEGWTDVSFAAQSIVGKGMQPKDLIAQGNAMFFVVFNLLATVFVLT
LFISVFMRNYTEQTGVAFLTAEQRSWLELRKLLRHISPSKSSYRDTEKAWKKWCHKRAIEKRGKWYQAITAVLVL
HLLLLVAEFRSEPRWWSETRTFVFLFFILIYVSNMAVRITGLGWTRFRRSSWDLYSLVTVSGAFVATMALLTTTN
RPNDTYTQLHKFFLVAIVLLLIPRNDALDQLFKTAAASLTVIGNLLATWLVFFLVFAIAMTQAFSLTRFGGEASS
NINFRSVPKALILLFRMSLGEGWNKIMEDYADIEPPLCVEQDKFFDSDCGSKAWARFLFVSWNIVSMYIFVNLFV
SLIYESFSYVYQRSSGVAVVDRDEIRRFKEAWRSVDPAGTGFISKESFPRLLGELSGVFQMRIYEPEDSVHRILD
DVRDDAQTSRHMSIGTSGAKGDIDIGKLNRRLALLDVDNIRERRRRFKIFFGEVLASADPDKGIAFADVLMILAH
YNIINDSKSLKLEEFLRRRARLQRVDEEIRRKVVQGFFDTLYWTRKFKKHMERKRASRMSEVPELAIPDILPKQD
NTARHTNTL*
Coding >Hirsu2|1560
ATGCTGGCTCCTCGCGTGGCGTCGAACCCCTACTTCGACTTTGACGATTTTGGGTCATCGCTTTTCACCCTTTTC
CAAATTGTCAGCCAGGAGGGATGGACGGACGTGTCATTCGCCGCACAAAGCATTGTGGGGAAAGGGATGCAACCT
AAAGATCTAATTGCTCAAGGCAACGCCATGTTCTTCGTTGTGTTCAACCTCCTTGCGACAGTTTTCGTCCTCACC
CTATTCATTTCGGTCTTCATGAGAAACTACACGGAGCAAACAGGCGTTGCCTTTCTCACCGCGGAGCAACGATCG
TGGCTGGAATTGCGGAAACTCCTACGCCACATCTCGCCGTCGAAGAGCTCGTACCGCGACACCGAAAAGGCCTGG
AAGAAGTGGTGCCACAAAAGAGCCATCGAGAAACGAGGCAAATGGTATCAGGCCATCACGGCCGTGCTCGTTCTG
CACCTACTTCTGCTAGTGGCAGAATTCAGGTCAGAGCCGAGATGGTGGTCGGAGACGCGTACCTTTGTATTCCTG
TTCTTCATTCTCATCTATGTGAGCAACATGGCGGTCCGAATCACCGGTCTCGGGTGGACTCGCTTCCGACGGAGC
TCTTGGGACCTGTACTCTCTGGTAACAGTGTCCGGAGCTTTCGTGGCAACCATGGCCCTCCTCACTACGACGAAC
AGACCCAATGACACATATACCCAGCTTCACAAATTCTTCCTCGTCGCCATCGTTCTGTTATTGATCCCTCGGAAT
GACGCTTTAGACCAGCTTTTCAAGACCGCTGCAGCAAGTTTAACGGTCATTGGTAATCTGCTGGCAACCTGGCTA
GTCTTCTTCCTCGTCTTTGCCATCGCCATGACTCAGGCTTTCAGCTTGACGCGATTTGGGGGAGAGGCGAGCTCC
AACATCAACTTCCGAAGCGTCCCAAAAGCACTGATTCTTCTATTCCGGATGAGTCTCGGTGAAGGCTGGAACAAG
ATCATGGAAGATTATGCCGACATTGAACCCCCACTGTGCGTCGAACAAGACAAGTTCTTCGACAGCGACTGCGGC
AGCAAGGCCTGGGCAAGATTTTTGTTCGTCTCGTGGAACATAGTGAGCATGTACATCTTTGTGAACCTCTTCGTC
TCTCTCATTTATGAGAGCTTCAGTTACGTCTACCAGCGCTCCAGCGGCGTAGCGGTCGTTGACAGGGACGAAATC
AGGCGGTTCAAAGAAGCTTGGAGGAGCGTGGACCCGGCCGGGACGGGCTTCATCTCGAAAGAGTCGTTCCCGCGT
CTCCTGGGAGAGTTGTCGGGCGTCTTTCAGATGCGTATATATGAGCCGGAAGACTCAGTACACCGGATCCTCGAC
GACGTACGGGACGACGCCCAGACGTCAAGGCACATGTCAATCGGGACATCCGGTGCAAAAGGCGACATTGACATC
GGCAAGTTAAACAGACGATTGGCCTTGCTGGATGTGGACAATATCCGAGAACGACGGCGGCGGTTCAAGATCTTT
TTCGGGGAAGTTTTGGCATCCGCCGATCCGGACAAGGGCATCGCCTTTGCCGACGTGTTGATGATTCTCGCGCAT
TACAACATCATCAACGATAGCAAAAGCCTCAAGCTCGAGGAATTTCTGCGCAGGCGAGCGCGATTGCAGCGTGTT
GACGAGGAAATACGGCGCAAGGTTGTTCAGGGATTCTTCGACACGCTATACTGGACGAGGAAGTTCAAAAAGCAT
ATGGAGCGTAAACGCGCGTCGCGGATGTCAGAGGTGCCGGAGCTGGCCATTCCAGATATTCTGCCGAAACAGGAC
AACACGGCGCGGCATACCAACACCCTCTGA
Transcript >Hirsu2|1560
ATGCTGGCTCCTCGCGTGGCGTCGAACCCCTACTTCGACTTTGACGATTTTGGGTCATCGCTTTTCACCCTTTTC
CAAATTGTCAGCCAGGAGGGATGGACGGACGTGTCATTCGCCGCACAAAGCATTGTGGGGAAAGGGATGCAACCT
AAAGATCTAATTGCTCAAGGCAACGCCATGTTCTTCGTTGTGTTCAACCTCCTTGCGACAGTTTTCGTCCTCACC
CTATTCATTTCGGTCTTCATGAGAAACTACACGGAGCAAACAGGCGTTGCCTTTCTCACCGCGGAGCAACGATCG
TGGCTGGAATTGCGGAAACTCCTACGCCACATCTCGCCGTCGAAGAGCTCGTACCGCGACACCGAAAAGGCCTGG
AAGAAGTGGTGCCACAAAAGAGCCATCGAGAAACGAGGCAAATGGTATCAGGCCATCACGGCCGTGCTCGTTCTG
CACCTACTTCTGCTAGTGGCAGAATTCAGGTCAGAGCCGAGATGGTGGTCGGAGACGCGTACCTTTGTATTCCTG
TTCTTCATTCTCATCTATGTGAGCAACATGGCGGTCCGAATCACCGGTCTCGGGTGGACTCGCTTCCGACGGAGC
TCTTGGGACCTGTACTCTCTGGTAACAGTGTCCGGAGCTTTCGTGGCAACCATGGCCCTCCTCACTACGACGAAC
AGACCCAATGACACATATACCCAGCTTCACAAATTCTTCCTCGTCGCCATCGTTCTGTTATTGATCCCTCGGAAT
GACGCTTTAGACCAGCTTTTCAAGACCGCTGCAGCAAGTTTAACGGTCATTGGTAATCTGCTGGCAACCTGGCTA
GTCTTCTTCCTCGTCTTTGCCATCGCCATGACTCAGGCTTTCAGCTTGACGCGATTTGGGGGAGAGGCGAGCTCC
AACATCAACTTCCGAAGCGTCCCAAAAGCACTGATTCTTCTATTCCGGATGAGTCTCGGTGAAGGCTGGAACAAG
ATCATGGAAGATTATGCCGACATTGAACCCCCACTGTGCGTCGAACAAGACAAGTTCTTCGACAGCGACTGCGGC
AGCAAGGCCTGGGCAAGATTTTTGTTCGTCTCGTGGAACATAGTGAGCATGTACATCTTTGTGAACCTCTTCGTC
TCTCTCATTTATGAGAGCTTCAGTTACGTCTACCAGCGCTCCAGCGGCGTAGCGGTCGTTGACAGGGACGAAATC
AGGCGGTTCAAAGAAGCTTGGAGGAGCGTGGACCCGGCCGGGACGGGCTTCATCTCGAAAGAGTCGTTCCCGCGT
CTCCTGGGAGAGTTGTCGGGCGTCTTTCAGATGCGTATATATGAGCCGGAAGACTCAGTACACCGGATCCTCGAC
GACGTACGGGACGACGCCCAGACGTCAAGGCACATGTCAATCGGGACATCCGGTGCAAAAGGCGACATTGACATC
GGCAAGTTAAACAGACGATTGGCCTTGCTGGATGTGGACAATATCCGAGAACGACGGCGGCGGTTCAAGATCTTT
TTCGGGGAAGTTTTGGCATCCGCCGATCCGGACAAGGGCATCGCCTTTGCCGACGTGTTGATGATTCTCGCGCAT
TACAACATCATCAACGATAGCAAAAGCCTCAAGCTCGAGGAATTTCTGCGCAGGCGAGCGCGATTGCAGCGTGTT
GACGAGGAAATACGGCGCAAGGTTGTTCAGGGATTCTTCGACACGCTATACTGGACGAGGAAGTTCAAAAAGCAT
ATGGAGCGTAAACGCGCGTCGCGGATGTCAGAGGTGCCGGAGCTGGCCATTCCAGATATTCTGCCGAAACAGGAC
AACACGGCGCGGCATACCAACACCCTCTGA
Gene >Hirsu2|1560
ATGCTGGCTCCTCGCGTGGCGTCGAACCCCTACTTCGACTTTGACGATTTTGGGTCATCGCTTTTCACCCTTTTC
CAAATTGTCAGCCAGGAGGGATGGACGGACGTGTCATTCGCCGCACAAAGCATTGTGGGGAAAGGGATGCAACCT
AAAGATCTAATTGCTCAAGGCAACGCCATGTTCTTCGTTGTGTTCAACCTCCTTGCGACAGTTTTCGTCCTCACC
CTATTCATTTCGGTCTTCATGAGAAACTACACGGAGCAAACAGGCGTTGCCTTTCTCACCGCGGAGCAACGATCG
TGGCTGGAATTGCGGAAACTCCTACGCCACATCTCGCCGTCGAAGAGCTCGTACCGCGACACCGAAAAGGCCTGG
AAGAAGTGGTGCCACAAAAGAGCCATCGAGAAACGAGGCAAATGGTATCAGGCCATCACGGCCGTGCTCGTTCTG
CACCTACTTCTGCTAGTGGCAGAATTCAGGTCAGAGCCGAGATGGTGGTCGGAGACGCGTACCTTTGTATTCCTG
TTCTTCATTCTCATCTATGTGAGCAACATGGCGGTCCGAATCACCGGTCTCGGGTGGACTCGCTTCCGACGGAGC
TCTTGGGACCTGTACTCTCTGGTAACAGTGTCCGGAGCTTTCGTGGCAACCATGGCCCTCCTCACTACGACGAAC
AGACCCAATGACACATATACCCAGCTTCACAAATTCTTCCTCGTCGCCATCGTTCTGTTATTGATCCCTCGGAAT
GACGCTTTAGACCAGCTTTTCAAGACCGCTGCAGCAAGTTTAACGGTCATTGGTAATCTGCTGGCAACCTGGCTA
GTCTTCTTCCTCGTCTTTGCCATCGCCATGACTCAGGCTTTCAGCTTGACGCGATTTGGGGGAGAGGCGAGCTCC
AACATCAACTTCCGAAGCGTCCCAAAAGCACTGATTCTTCTATTCCGGATGAGTCTCGGTGAAGGCTGGAACAAG
ATCATGGAAGATTATGCCGACATTGAACCCCCACTGTGCGTCGAACAAGACAAGTTCTTCGACAGCGACTGCGGC
AGCAAGGCCTGGGCAAGATTTTTGTTCGTCTCGTGGAACATAGTGAGCATGTACATCTTTGTGAACCTCTTCGTC
TCTCTCATTTATGAGAGCTTCAGTTACGTCTACCAGCGCTCCAGCGGCGTAGCGGTCGTTGACAGGGACGAAATC
AGGCGGTTCAAAGAAGCTTGGAGGAGCGTGGACCCGGCCGGGACGGGCTTCATCTCGAAAGAGTCGTTCCCGCGT
CTCCTGGGAGAGTTGTCGGGCGTCTTTCAGATGCGTATATATGAGCCGGAAGACTCAGTACACCGGATCCTCGAC
GACGTACGGGACGACGCCCAGACGTCAAGGCACATGTCAATCGGGACATCCGGTGCAAAAGGCGACATTGACATC
GGCAAGTTAAACAGACGATTGGCCTTGCTGGATGTGGACAATATCCGAGAACGACGGCGGCGGTTCAAGATCTTT
TTCGGGGAAGTTTTGGCATCCGCCGATCCGGACAAGGGCATCGCCTTTGCCGACGTGTTGATGATTCTCGCGCAT
TACAACATCATCAACGATAGCAAAAGCCTCAAGTACGTCGGAAGACCCCGTCTCCCTTGCCAGCTGTCGGGCTCC
AATTGGCTGCCCGCTCCCCGCCCTCGGAGCCTAAGCGTGGACGAGCAACTGACGGTTCTTTCCAGGCTCGAGGAA
TTTCTGCGCAGGCGAGCGCGATTGCAGCGTGTTGACGAGGAAATACGGCGCAAGGTTGTTCAGGGATTCTTCGAC
ACGCTGTGAGTCTATGACATTGAGACGTACGGGCGCGAGCAAAGCCGATCTGACTGGGTACGCGGCAGATACTGG
ACGAGGAAGTTCAAAAAGCATATGGAGCGTAAACGCGCGTCGCGGATGTCAGAGGTGCCGGAGCTGGCCATTCCA
GATATTCTGGTAGACGAGAACAGCGGTGACGGGGAAAGCCGGAAGTCGTTCAAGCCCGACGAAGGATTGACGACG
CGGTGGACGCACCTTAGCATCGGGGAAGGGGTGGGGCAAGAGACGCGGACCGGCAAACCAGCCGAAACAGGACAA
CACGGCGCGGCATACCAACACCCTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail