Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1554
Gene name
LocationContig_1347:71..2060
Strand-
Gene length (bp)1989
Transcript length (bp)1851
Coding sequence length (bp)1851
Protein length (aa) 617

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) 2.0E-27 3 386
PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) 1.1E-09 394 555
PF13603 tRNA-synt_1_2 Leucyl-tRNA synthetase, Domain 2 2.6E-39 186 379
PF09334 tRNA-synt_1g tRNA synthetases class I (M) 7.1E-22 2 134

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15181|SYLM_NEUCR Leucine--tRNA ligase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=leu-5 PE=3 SV=1 1 616 0.0E+00
sp|P13503|SYLM_SACPA Leucine--tRNA ligase, mitochondrial OS=Saccharomyces paradoxus GN=NAM2 PE=3 SV=1 2 616 0.0E+00
sp|P11325|SYLM_YEAST Leucine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM2 PE=1 SV=1 2 614 0.0E+00
sp|Q114V5|SYL_TRIEI Leucine--tRNA ligase OS=Trichodesmium erythraeum (strain IMS101) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|B1WSK6|SYL_CYAA5 Leucine--tRNA ligase OS=Cyanothece sp. (strain ATCC 51142) GN=leuS PE=3 SV=1 1 616 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15181|SYLM_NEUCR Leucine--tRNA ligase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=leu-5 PE=3 SV=1 1 616 0.0E+00
sp|P13503|SYLM_SACPA Leucine--tRNA ligase, mitochondrial OS=Saccharomyces paradoxus GN=NAM2 PE=3 SV=1 2 616 0.0E+00
sp|P11325|SYLM_YEAST Leucine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM2 PE=1 SV=1 2 614 0.0E+00
sp|Q114V5|SYL_TRIEI Leucine--tRNA ligase OS=Trichodesmium erythraeum (strain IMS101) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|B1WSK6|SYL_CYAA5 Leucine--tRNA ligase OS=Cyanothece sp. (strain ATCC 51142) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|B7KCI7|SYL_CYAP7 Leucine--tRNA ligase OS=Cyanothece sp. (strain PCC 7424) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|Q8DH61|SYL_THEEB Leucine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|B7JYA9|SYL_CYAP8 Leucine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|Q0IAE0|SYL_SYNS3 Leucine--tRNA ligase OS=Synechococcus sp. (strain CC9311) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|Q7TV01|SYL_PROMM Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|A5GL71|SYL_SYNPW Leucine--tRNA ligase OS=Synechococcus sp. (strain WH7803) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|Q7U6T1|SYL_SYNPX Leucine--tRNA ligase OS=Synechococcus sp. (strain WH8102) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|P73274|SYL_SYNY3 Leucine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|A2C9U0|SYL_PROM3 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9303) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|Q31LW9|SYL_SYNE7 Leucine--tRNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|B1XP90|SYL_SYNP2 Leucine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|B2J7T9|SYL_NOSP7 Leucine--tRNA ligase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=leuS PE=3 SV=1 1 614 0.0E+00
sp|B0C1R1|SYL_ACAM1 Leucine--tRNA ligase OS=Acaryochloris marina (strain MBIC 11017) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|Q09828|SYLM_SCHPO Putative leucine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.09 PE=3 SV=1 1 614 0.0E+00
sp|B8HM05|SYL_CYAP4 Leucine--tRNA ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|A5GT82|SYL_SYNR3 Leucine--tRNA ligase OS=Synechococcus sp. (strain RCC307) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|Q46L15|SYL_PROMT Leucine--tRNA ligase OS=Prochlorococcus marinus (strain NATL2A) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|A2C242|SYL_PROM1 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain NATL1A) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|A9BAE4|SYL_PROM4 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9211) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|Q5N006|SYL_SYNP6 Leucine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|A2BWL7|SYL_PROM5 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|A2BR45|SYL_PROMS Leucine--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|Q7NE01|SYL_GLOVI Leucine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|Q8YS09|SYL_NOSS1 Leucine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=leuS PE=3 SV=1 1 614 0.0E+00
sp|Q3M3A3|SYL_ANAVT Leucine--tRNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=leuS PE=3 SV=1 1 614 0.0E+00
sp|A8G4T7|SYL_PROM2 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|A3PCW8|SYL_PROM0 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|Q7V1I2|SYL_PROMP Leucine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|Q3AXV7|SYL_SYNS9 Leucine--tRNA ligase OS=Synechococcus sp. (strain CC9902) GN=leuS PE=3 SV=1 1 616 0.0E+00
sp|Q31AX4|SYL_PROM9 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=leuS PE=3 SV=1 1 616 9.0E-180
sp|Q2JV13|SYL_SYNJA Leucine--tRNA ligase OS=Synechococcus sp. (strain JA-3-3Ab) GN=leuS PE=3 SV=1 1 616 1.0E-179
sp|Q7VBZ5|SYL_PROMA Leucine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=leuS PE=3 SV=1 1 614 2.0E-176
sp|Q3AJU8|SYL_SYNSC Leucine--tRNA ligase OS=Synechococcus sp. (strain CC9605) GN=leuS PE=3 SV=1 1 616 1.0E-175
sp|A0L4R4|SYL_MAGMM Leucine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=leuS PE=3 SV=1 1 616 3.0E-175
sp|Q2JHX0|SYL_SYNJB Leucine--tRNA ligase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=leuS PE=3 SV=1 1 616 3.0E-175
sp|Q0ABN3|SYL_ALKEH Leucine--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=leuS PE=3 SV=1 1 616 3.0E-175
sp|Q3SG58|SYL_THIDA Leucine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=leuS PE=3 SV=1 1 616 2.0E-174
sp|Q0AKF5|SYL_MARMM Leucine--tRNA ligase OS=Maricaulis maris (strain MCS10) GN=leuS PE=3 SV=1 1 616 2.0E-173
sp|Q1I4G7|SYL_PSEE4 Leucine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=leuS PE=3 SV=1 1 616 7.0E-173
sp|Q87VX3|SYL_PSESM Leucine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=leuS PE=3 SV=1 1 616 8.0E-173
sp|A4XYW8|SYL_PSEMY Leucine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=leuS PE=3 SV=2 1 616 2.0E-172
sp|Q02SF5|SYL_PSEAB Leucine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=leuS PE=3 SV=1 1 616 4.0E-172
sp|A4VQZ0|SYL_PSEU5 Leucine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=leuS PE=3 SV=2 1 616 5.0E-172
sp|B1J150|SYL_PSEPW Leucine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=leuS PE=3 SV=1 1 616 5.0E-172
sp|Q48DN1|SYL_PSE14 Leucine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=leuS PE=3 SV=1 1 616 7.0E-172
sp|Q9HX33|SYL_PSEAE Leucine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=leuS PE=3 SV=1 1 616 7.0E-172
sp|B7V9C9|SYL_PSEA8 Leucine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=leuS PE=3 SV=1 1 616 9.0E-172
sp|A6V0C2|SYL_PSEA7 Leucine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=leuS PE=3 SV=1 1 616 1.0E-171
sp|Q4ZN90|SYL_PSEU2 Leucine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=leuS PE=3 SV=1 1 616 2.0E-171
sp|Q88DN1|SYL_PSEPK Leucine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=leuS PE=3 SV=1 1 616 2.0E-171
sp|A5W9H9|SYL_PSEP1 Leucine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=leuS PE=3 SV=2 1 616 2.0E-171
sp|Q8RIQ3|SYL_FUSNN Leucine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=leuS PE=3 SV=1 1 616 2.0E-171
sp|B0KJW8|SYL_PSEPG Leucine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=leuS PE=3 SV=1 1 616 5.0E-171
sp|Q4K5H6|SYL_PSEF5 Leucine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=leuS PE=3 SV=1 1 616 6.0E-171
sp|Q9WY15|SYL_THEMA Leucine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=leuS PE=3 SV=1 1 616 8.0E-171
sp|C1DMV9|SYL_AZOVD Leucine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=leuS PE=3 SV=1 1 616 8.0E-171
sp|C3K2L2|SYL_PSEFS Leucine--tRNA ligase OS=Pseudomonas fluorescens (strain SBW25) GN=leuS PE=3 SV=1 1 616 1.0E-170
sp|A9WWT1|SYL_BRUSI Leucine--tRNA ligase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=leuS PE=3 SV=1 1 616 1.0E-170
sp|A5VSE9|SYL_BRUO2 Leucine--tRNA ligase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=leuS PE=3 SV=2 1 616 1.0E-170
sp|Q8YJ44|SYL_BRUME Leucine--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=leuS PE=3 SV=1 1 616 1.0E-170
sp|C0RF58|SYL_BRUMB Leucine--tRNA ligase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=leuS PE=3 SV=1 1 616 1.0E-170
sp|Q2YLH9|SYL_BRUA2 Leucine--tRNA ligase OS=Brucella abortus (strain 2308) GN=leuS PE=3 SV=1 1 616 1.0E-170
sp|B2S7N1|SYL_BRUA1 Leucine--tRNA ligase OS=Brucella abortus (strain S19) GN=leuS PE=3 SV=1 1 616 1.0E-170
sp|Q8FYQ7|SYL_BRUSU Leucine--tRNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=leuS PE=3 SV=1 1 616 2.0E-170
sp|Q57B80|SYL_BRUAB Leucine--tRNA ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=leuS PE=3 SV=1 1 616 2.0E-170
sp|B6IU54|SYL_RHOCS Leucine--tRNA ligase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=leuS PE=3 SV=1 1 616 2.0E-170
sp|A9M845|SYL_BRUC2 Leucine--tRNA ligase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=leuS PE=3 SV=1 1 616 3.0E-170
sp|Q9A217|SYL_CAUCR Leucine--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=leuS PE=3 SV=1 1 614 4.0E-170
sp|B8GW27|SYL_CAUCN Leucine--tRNA ligase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=leuS PE=3 SV=1 1 614 4.0E-170
sp|A8IMK0|SYL_AZOC5 Leucine--tRNA ligase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=leuS PE=3 SV=1 1 614 8.0E-170
sp|B0V5H2|SYL_ACIBY Leucine--tRNA ligase OS=Acinetobacter baumannii (strain AYE) GN=leuS PE=3 SV=1 1 616 1.0E-169
sp|B2HTC4|SYL_ACIBC Leucine--tRNA ligase OS=Acinetobacter baumannii (strain ACICU) GN=leuS PE=3 SV=1 1 616 1.0E-169
sp|B7I5I5|SYL_ACIB5 Leucine--tRNA ligase OS=Acinetobacter baumannii (strain AB0057) GN=leuS PE=3 SV=1 1 616 1.0E-169
sp|B7H051|SYL_ACIB3 Leucine--tRNA ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=leuS PE=3 SV=1 1 616 2.0E-169
sp|Q13E15|SYL_RHOPS Leucine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisB5) GN=leuS PE=3 SV=1 1 616 3.0E-169
sp|B0VKP9|SYL_ACIBS Leucine--tRNA ligase OS=Acinetobacter baumannii (strain SDF) GN=leuS PE=3 SV=1 1 616 4.0E-169
sp|A6TQK3|SYL_ALKMQ Leucine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=leuS PE=3 SV=1 1 616 5.0E-169
sp|Q608N7|SYL_METCA Leucine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=leuS PE=3 SV=1 1 616 5.0E-169
sp|Q2K2S7|SYL_RHIEC Leucine--tRNA ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=leuS PE=3 SV=1 1 616 6.0E-169
sp|Q820M7|SYL_NITEU Leucine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=leuS PE=3 SV=1 1 616 1.0E-168
sp|B6JAI4|SYL_OLICO Leucine--tRNA ligase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=leuS PE=3 SV=1 1 616 2.0E-168
sp|Q5NMK1|SYL_ZYMMO Leucine--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=leuS PE=3 SV=1 1 616 3.0E-168
sp|Q6F817|SYL_ACIAD Leucine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=leuS PE=3 SV=1 1 616 8.0E-168
sp|Q6FYL6|SYL_BARQU Leucine--tRNA ligase OS=Bartonella quintana (strain Toulouse) GN=leuS PE=3 SV=1 1 616 2.0E-167
sp|A5WGH9|SYL_PSYWF Leucine--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=leuS PE=3 SV=1 1 616 2.0E-167
sp|C1DA02|SYL_LARHH Leucine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=leuS PE=3 SV=1 1 616 3.0E-167
sp|Q7P0R1|SYL_CHRVO Leucine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=leuS PE=3 SV=1 1 616 5.0E-167
sp|Q2G3C3|SYL_NOVAD Leucine--tRNA ligase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=leuS PE=3 SV=1 1 616 5.0E-167
sp|Q0AG57|SYL_NITEC Leucine--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=leuS PE=3 SV=1 1 616 5.0E-167
sp|Q3K6B0|SYL_PSEPF Leucine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=leuS PE=3 SV=1 1 616 6.0E-167
sp|Q0BW99|SYL_GRABC Leucine--tRNA ligase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=leuS PE=3 SV=1 1 616 1.0E-166
sp|Q5P252|SYL_AROAE Leucine--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=leuS PE=3 SV=1 1 616 1.0E-166
sp|A4JBI1|SYL_BURVG Leucine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=leuS PE=3 SV=1 1 616 1.0E-166
sp|Q1QDA4|SYL_PSYCK Leucine--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=leuS PE=3 SV=2 1 616 1.0E-166
sp|B3PS46|SYL_RHIE6 Leucine--tRNA ligase OS=Rhizobium etli (strain CIAT 652) GN=leuS PE=3 SV=1 1 616 1.0E-166
sp|Q2RN70|SYL_RHORT Leucine--tRNA ligase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=leuS PE=3 SV=1 1 616 2.0E-166
sp|Q4FU71|SYL_PSYA2 Leucine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=leuS PE=3 SV=1 1 616 2.0E-166
sp|Q2J364|SYL_RHOP2 Leucine--tRNA ligase OS=Rhodopseudomonas palustris (strain HaA2) GN=leuS PE=3 SV=1 1 616 2.0E-166
sp|A6WXW1|SYL_OCHA4 Leucine--tRNA ligase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=leuS PE=3 SV=1 1 616 3.0E-166
sp|B0T6E7|SYL_CAUSK Leucine--tRNA ligase OS=Caulobacter sp. (strain K31) GN=leuS PE=3 SV=1 1 614 4.0E-166
sp|Q21CM7|SYL_RHOPB Leucine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisB18) GN=leuS PE=3 SV=1 1 616 8.0E-166
sp|A9IYY8|SYL_BART1 Leucine--tRNA ligase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=leuS PE=3 SV=1 1 616 8.0E-166
sp|Q11DE4|SYL_CHESB Leucine--tRNA ligase OS=Chelativorans sp. (strain BNC1) GN=leuS PE=3 SV=1 1 616 9.0E-166
sp|A5CCT4|SYL_ORITB Leucine--tRNA ligase OS=Orientia tsutsugamushi (strain Boryong) GN=leuS PE=3 SV=1 1 616 2.0E-165
sp|A1UR39|SYL_BARBK Leucine--tRNA ligase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=leuS PE=3 SV=1 1 616 2.0E-165
sp|B2JGX6|SYL_BURP8 Leucine--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=leuS PE=3 SV=1 1 616 3.0E-165
sp|O66680|SYLA_AQUAE Leucine--tRNA ligase subunit alpha OS=Aquifex aeolicus (strain VF5) GN=leuS PE=1 SV=1 1 557 4.0E-165
sp|A6UEE2|SYL_SINMW Leucine--tRNA ligase OS=Sinorhizobium medicae (strain WSM419) GN=leuS PE=3 SV=1 1 616 4.0E-165
sp|A5VA89|SYL_SPHWW Leucine--tRNA ligase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=leuS PE=3 SV=1 1 616 8.0E-165
sp|Q89WQ1|SYL_BRADU Leucine--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuS PE=3 SV=1 1 616 9.0E-165
sp|B3Q8A1|SYL_RHOPT Leucine--tRNA ligase OS=Rhodopseudomonas palustris (strain TIE-1) GN=leuS PE=3 SV=1 1 616 1.0E-164
sp|A5IKQ3|SYL_THEP1 Leucine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=leuS PE=3 SV=1 1 616 2.0E-164
sp|C3MB60|SYL_RHISN Leucine--tRNA ligase OS=Rhizobium sp. (strain NGR234) GN=leuS PE=3 SV=1 1 616 2.0E-164
sp|Q13U82|SYL_BURXL Leucine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=leuS PE=3 SV=1 1 616 2.0E-164
sp|Q2YBQ2|SYL_NITMU Leucine--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=leuS PE=3 SV=1 1 616 2.0E-164
sp|Q98EU7|SYL_RHILO Leucine--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=leuS PE=3 SV=1 1 616 3.0E-164
sp|Q92KW8|SYL_RHIME Leucine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=leuS PE=3 SV=1 1 616 3.0E-164
sp|Q31IE8|SYL_THICR Leucine--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=leuS PE=3 SV=1 1 616 4.0E-164
sp|A9M162|SYL_NEIM0 Leucine--tRNA ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=leuS PE=3 SV=2 1 616 4.0E-164
sp|Q6ND22|SYL_RHOPA Leucine--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=leuS PE=3 SV=1 1 616 6.0E-164
sp|A7HSL7|SYL_PARL1 Leucine--tRNA ligase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=leuS PE=3 SV=1 1 616 8.0E-164
sp|Q5FTV3|SYL_GLUOX Leucine--tRNA ligase OS=Gluconobacter oxydans (strain 621H) GN=leuS PE=3 SV=1 1 616 8.0E-164
sp|B0U376|SYL_XYLFM Leucine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=leuS PE=3 SV=1 1 616 1.0E-163
sp|B8GV13|SYL_THISH Leucine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=leuS PE=3 SV=1 1 616 1.0E-163
sp|Q0BIB5|SYL_BURCM Leucine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=leuS PE=3 SV=1 1 616 1.0E-163
sp|B3CLT1|SYL_WOLPP Leucine--tRNA ligase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=leuS PE=3 SV=1 1 616 1.0E-163
sp|A1WYZ7|SYL_HALHL Leucine--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=leuS PE=3 SV=1 1 616 2.0E-163
sp|A5E8H4|SYL_BRASB Leucine--tRNA ligase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=leuS PE=3 SV=1 1 616 2.0E-163
sp|Q54ET5|SYLM_DICDI Leucine--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=mleuS PE=3 SV=1 2 614 2.0E-163
sp|B1YTA7|SYL_BURA4 Leucine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=leuS PE=3 SV=1 1 616 2.0E-163
sp|Q0AWK4|SYL_SYNWW Leucine--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=leuS PE=3 SV=1 1 616 2.0E-163
sp|Q2SZ91|SYL_BURTA Leucine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=leuS PE=3 SV=2 1 616 4.0E-163
sp|B0U0E8|SYL_FRAP2 Leucine--tRNA ligase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=leuS PE=3 SV=1 1 616 4.0E-163
sp|Q0BWB5|SYL_HYPNA Leucine--tRNA ligase OS=Hyphomonas neptunium (strain ATCC 15444) GN=leuS PE=3 SV=1 1 616 5.0E-163
sp|A9AHA9|SYL_BURM1 Leucine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=leuS PE=3 SV=1 1 616 6.0E-163
sp|Q3SWI2|SYL_NITWN Leucine--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=leuS PE=3 SV=1 1 616 7.0E-163
sp|Q87C65|SYL_XYLFT Leucine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=leuS PE=3 SV=1 1 616 7.0E-163
sp|B2I5T5|SYL_XYLF2 Leucine--tRNA ligase OS=Xylella fastidiosa (strain M23) GN=leuS PE=3 SV=1 1 616 7.0E-163
sp|A1U4A0|SYL_MARHV Leucine--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=leuS PE=3 SV=2 1 616 8.0E-163
sp|Q1MA25|SYL2_RHIL3 Leucine--tRNA ligase 2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=leuS2 PE=3 SV=1 1 616 9.0E-163
sp|B4RNT1|SYL_NEIG2 Leucine--tRNA ligase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=leuS PE=3 SV=1 1 616 9.0E-163
sp|Q5FAJ3|SYL_NEIG1 Leucine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=leuS PE=3 SV=2 1 616 1.0E-162
sp|Q1RJS2|SYL_RICBR Leucine--tRNA ligase OS=Rickettsia bellii (strain RML369-C) GN=leuS PE=3 SV=1 1 616 1.0E-162
sp|B8F9F0|SYL_DESAA Leucine--tRNA ligase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=leuS PE=3 SV=1 1 616 2.0E-162
sp|Q0BLI7|SYL_FRATO Leucine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=leuS PE=3 SV=1 1 616 2.0E-162
sp|Q2A307|SYL_FRATH Leucine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=leuS PE=3 SV=1 1 616 2.0E-162
sp|A7NCQ3|SYL_FRATF Leucine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=leuS PE=3 SV=1 1 616 2.0E-162
sp|Q9PBG8|SYL_XYLFA Leucine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=leuS PE=3 SV=2 1 616 3.0E-162
sp|A4IXU1|SYL_FRATW Leucine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=leuS PE=3 SV=1 1 616 3.0E-162
sp|B5ZV40|SYL_RHILW Leucine--tRNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=leuS PE=3 SV=1 1 616 3.0E-162
sp|A4YJS8|SYL_BRASO Leucine--tRNA ligase OS=Bradyrhizobium sp. (strain ORS278) GN=leuS PE=3 SV=1 1 616 3.0E-162
sp|A5G068|SYL_ACICJ Leucine--tRNA ligase OS=Acidiphilium cryptum (strain JF-5) GN=leuS PE=3 SV=1 1 616 4.0E-162
sp|C0QWR3|SYL_BRAHW Leucine--tRNA ligase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=leuS PE=3 SV=1 1 616 5.0E-162
sp|Q3A4P8|SYL_PELCD Leucine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=leuS PE=3 SV=1 1 616 5.0E-162
sp|Q5NG64|SYL_FRATT Leucine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=leuS PE=3 SV=1 1 616 7.0E-162
sp|Q14HL6|SYL_FRAT1 Leucine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=leuS PE=3 SV=1 1 616 7.0E-162
sp|Q2LQK5|SYL_SYNAS Leucine--tRNA ligase OS=Syntrophus aciditrophicus (strain SB) GN=leuS PE=3 SV=1 1 616 7.0E-162
sp|B8CXR8|SYL_HALOH Leucine--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=leuS PE=3 SV=1 1 616 9.0E-162
sp|A0Q693|SYL_FRATN Leucine--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=leuS PE=3 SV=1 1 616 9.0E-162
sp|Q6G1W2|SYL_BARHE Leucine--tRNA ligase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=leuS PE=3 SV=1 1 616 1.0E-161
sp|Q2WBE4|SYL_MAGSA Leucine--tRNA ligase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=leuS PE=3 SV=1 1 616 1.0E-161
sp|A8GNE3|SYL_RICAH Leucine--tRNA ligase OS=Rickettsia akari (strain Hartford) GN=leuS PE=3 SV=1 1 616 1.0E-161
sp|B1I5R7|SYL_DESAP Leucine--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=leuS PE=3 SV=1 1 616 1.0E-161
sp|A7NFJ2|SYL_ROSCS Leucine--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=leuS PE=3 SV=1 1 558 1.0E-161
sp|Q1LJ30|SYL_CUPMC Leucine--tRNA ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=leuS PE=3 SV=1 1 616 1.0E-161
sp|B1JVG9|SYL_BURCC Leucine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=leuS PE=3 SV=1 1 616 2.0E-161
sp|A0K4I0|SYL_BURCH Leucine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=leuS PE=3 SV=1 1 616 2.0E-161
sp|Q1BZ70|SYL_BURCA Leucine--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=leuS PE=3 SV=1 1 616 2.0E-161
sp|Q39JM5|SYL_BURL3 Leucine--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=leuS PE=3 SV=1 1 616 3.0E-161
sp|Q3JNN1|SYL_BURP1 Leucine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=leuS PE=3 SV=2 1 616 5.0E-161
sp|A3NDK5|SYL_BURP6 Leucine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=leuS PE=3 SV=1 1 616 5.0E-161
sp|Q63QT6|SYL_BURPS Leucine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=leuS PE=3 SV=1 1 616 6.0E-161
sp|A3NZB6|SYL_BURP0 Leucine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=leuS PE=3 SV=1 1 616 6.0E-161
sp|A1KAH5|SYL_AZOSB Leucine--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=leuS PE=3 SV=1 1 616 7.0E-161
sp|B2SGM9|SYL_FRATM Leucine--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=leuS PE=3 SV=1 1 616 7.0E-161
sp|A8GS16|SYL_RICRS Leucine--tRNA ligase OS=Rickettsia rickettsii (strain Sheila Smith) GN=leuS PE=3 SV=1 1 616 1.0E-160
sp|B0BXI2|SYL_RICRO Leucine--tRNA ligase OS=Rickettsia rickettsii (strain Iowa) GN=leuS PE=3 SV=1 1 616 1.0E-160
sp|Q1QRZ8|SYL_NITHX Leucine--tRNA ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=leuS PE=3 SV=1 1 616 2.0E-160
sp|Q4ULS1|SYL_RICFE Leucine--tRNA ligase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=leuS PE=3 SV=1 1 616 2.0E-160
sp|B4EEW1|SYL_BURCJ Leucine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=leuS PE=3 SV=1 1 616 2.0E-160
sp|B2A6C2|SYL_NATTJ Leucine--tRNA ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=leuS PE=3 SV=1 1 573 2.0E-160
sp|A2S5J4|SYL_BURM9 Leucine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=leuS PE=3 SV=1 1 616 2.0E-160
sp|A3MPH9|SYL_BURM7 Leucine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=leuS PE=3 SV=1 1 616 2.0E-160
sp|A5V1W3|SYL_ROSS1 Leucine--tRNA ligase OS=Roseiflexus sp. (strain RS-1) GN=leuS PE=3 SV=1 1 614 3.0E-160
sp|A1V0G7|SYL_BURMS Leucine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=leuS PE=3 SV=1 1 616 3.0E-160
sp|Q62H20|SYL_BURMA Leucine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=leuS PE=3 SV=1 1 616 3.0E-160
sp|Q73IT7|SYL_WOLPM Leucine--tRNA ligase OS=Wolbachia pipientis wMel GN=leuS PE=3 SV=1 1 616 3.0E-160
sp|Q2RKZ1|SYL_MOOTA Leucine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=leuS PE=3 SV=1 1 616 4.0E-160
sp|Q3J7S8|SYL_NITOC Leucine--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=leuS PE=3 SV=1 1 616 5.0E-160
sp|A9BF22|SYL_PETMO Leucine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=leuS PE=3 SV=1 1 614 6.0E-160
sp|Q8P7J1|SYL_XANCP Leucine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=leuS PE=3 SV=2 1 616 8.0E-160
sp|A6LJM9|SYL_THEM4 Leucine--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=leuS PE=3 SV=1 1 616 1.0E-159
sp|A8F1J5|SYL_RICM5 Leucine--tRNA ligase OS=Rickettsia massiliae (strain Mtu5) GN=leuS PE=3 SV=1 1 616 2.0E-159
sp|B2SWH2|SYL_XANOP Leucine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=leuS PE=3 SV=1 1 616 2.0E-159
sp|Q4UWK8|SYL_XANC8 Leucine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=leuS PE=3 SV=2 1 616 2.0E-159
sp|Q2GDQ6|SYL_NEOSM Leucine--tRNA ligase OS=Neorickettsia sennetsu (strain Miyayama) GN=leuS PE=3 SV=2 1 616 2.0E-159
sp|Q5GXI8|SYL_XANOR Leucine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=leuS PE=3 SV=1 1 616 3.0E-159
sp|Q2P0N0|SYL_XANOM Leucine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=leuS PE=3 SV=1 1 616 3.0E-159
sp|B0RR06|SYL_XANCB Leucine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=leuS PE=3 SV=2 1 616 4.0E-159
sp|Q9JW39|SYL_NEIMA Leucine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=leuS PE=3 SV=1 1 616 5.0E-159
sp|Q47IN0|SYL_DECAR Leucine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=leuS PE=3 SV=2 1 616 8.0E-159
sp|Q8UBV2|SYL_AGRFC Leucine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=leuS PE=3 SV=1 1 616 8.0E-159
sp|B5EE39|SYL_GEOBB Leucine--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=leuS PE=3 SV=1 1 616 1.0E-158
sp|Q92I35|SYL_RICCN Leucine--tRNA ligase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=leuS PE=3 SV=1 1 616 1.0E-158
sp|Q68WV8|SYL_RICTY Leucine--tRNA ligase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=leuS PE=3 SV=1 1 616 2.0E-158
sp|B2UCA1|SYL_RALPJ Leucine--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=leuS PE=3 SV=1 1 616 2.0E-158
sp|Q3BRE4|SYL_XANC5 Leucine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=leuS PE=3 SV=2 1 616 3.0E-158
sp|B4SRE7|SYL_STRM5 Leucine--tRNA ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=leuS PE=3 SV=1 1 616 3.0E-158
sp|C0R573|SYL_WOLWR Leucine--tRNA ligase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=leuS PE=3 SV=1 1 616 3.0E-158
sp|B9JV46|SYL_AGRVS Leucine--tRNA ligase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=leuS PE=3 SV=1 1 616 4.0E-158
sp|C4K297|SYL_RICPU Leucine--tRNA ligase OS=Rickettsia peacockii (strain Rustic) GN=leuS PE=3 SV=1 1 616 4.0E-158
sp|C6E100|SYL_GEOSM Leucine--tRNA ligase OS=Geobacter sp. (strain M21) GN=leuS PE=3 SV=1 1 616 6.0E-158
sp|B4RCZ4|SYL_PHEZH Leucine--tRNA ligase OS=Phenylobacterium zucineum (strain HLK1) GN=leuS PE=3 SV=1 1 614 6.0E-158
sp|A4SVD9|SYL_POLSQ Leucine--tRNA ligase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=leuS PE=3 SV=1 1 616 8.0E-158
sp|A5IBJ1|SYL_LEGPC Leucine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=leuS PE=3 SV=1 1 616 9.0E-158
sp|A4J7H2|SYL_DESRM Leucine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=leuS PE=3 SV=1 1 616 1.0E-157
sp|B8DJF0|SYL_DESVM Leucine--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=leuS PE=3 SV=1 1 616 1.0E-157
sp|A8EZ02|SYL_RICCK Leucine--tRNA ligase OS=Rickettsia canadensis (strain McKiel) GN=leuS PE=3 SV=1 1 616 1.0E-157
sp|Q5X5L8|SYL_LEGPA Leucine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=leuS PE=3 SV=1 1 616 1.0E-157
sp|A7HN82|SYL_FERNB Leucine--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=leuS PE=3 SV=1 1 616 2.0E-157
sp|Q9JXT2|SYL_NEIMB Leucine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=leuS PE=1 SV=1 1 616 2.0E-157
sp|A4XKG9|SYL_CALS8 Leucine--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=leuS PE=3 SV=1 1 554 2.0E-157
sp|Q5ZVU2|SYL_LEGPH Leucine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=leuS PE=3 SV=1 1 616 2.0E-157
sp|C3PNE7|SYL_RICAE Leucine--tRNA ligase OS=Rickettsia africae (strain ESF-5) GN=leuS PE=3 SV=1 1 616 2.0E-157
sp|Q8PIW4|SYL_XANAC Leucine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=leuS PE=3 SV=1 1 616 3.0E-157
sp|Q8XVT3|SYL_RALSO Leucine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=leuS PE=3 SV=1 1 616 3.0E-157
sp|A1KS07|SYL_NEIMF Leucine--tRNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=leuS PE=3 SV=1 1 616 3.0E-157
sp|Q46XD8|SYL_CUPPJ Leucine--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=leuS PE=3 SV=2 1 616 5.0E-157
sp|Q74AZ0|SYL_GEOSL Leucine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=leuS PE=3 SV=1 1 616 5.0E-157
sp|B2FPR7|SYL_STRMK Leucine--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=leuS PE=3 SV=1 1 616 5.0E-157
sp|Q2SBE7|SYL_HAHCH Leucine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=leuS PE=3 SV=1 1 616 1.0E-156
sp|Q5WWZ8|SYL_LEGPL Leucine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=leuS PE=3 SV=1 1 616 2.0E-156
sp|Q9ZDB1|SYL_RICPR Leucine--tRNA ligase OS=Rickettsia prowazekii (strain Madrid E) GN=leuS PE=3 SV=1 1 616 2.0E-156
sp|B8EQP4|SYL_METSB Leucine--tRNA ligase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=leuS PE=3 SV=1 1 616 3.0E-156
sp|Q1MS17|SYL_LAWIP Leucine--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=leuS PE=3 SV=1 1 616 3.0E-156
sp|Q67SB4|SYL_SYMTH Leucine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=leuS PE=3 SV=1 1 616 4.0E-156
sp|Q24SP5|SYL_DESHY Leucine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=leuS PE=3 SV=1 1 616 5.0E-156
sp|B8FUR3|SYL_DESHD Leucine--tRNA ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=leuS PE=3 SV=1 1 616 5.0E-156
sp|Q220P5|SYL_RHOFT Leucine--tRNA ligase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=leuS PE=3 SV=1 1 616 5.0E-156
sp|A9HWW6|SYL_BORPD Leucine--tRNA ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=leuS PE=3 SV=1 1 611 6.0E-156
sp|Q1GNP7|SYL_SPHAL Leucine--tRNA ligase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=leuS PE=3 SV=1 1 616 1.0E-155
sp|B1XT72|SYL_POLNS Leucine--tRNA ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=leuS PE=3 SV=1 1 616 2.0E-155
sp|A5G677|SYL_GEOUR Leucine--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=leuS PE=3 SV=1 1 616 2.0E-155
sp|A1TVU7|SYL_ACIAC Leucine--tRNA ligase OS=Acidovorax citrulli (strain AAC00-1) GN=leuS PE=3 SV=1 1 616 2.0E-155
sp|A3DEU0|SYL_CLOTH Leucine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=leuS PE=3 SV=1 1 616 4.0E-155
sp|Q6AEW2|SYL_LEIXX Leucine--tRNA ligase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=leuS PE=3 SV=1 1 554 4.0E-155
sp|Q07UN5|SYL_RHOP5 Leucine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisA53) GN=leuS PE=3 SV=1 1 616 6.0E-155
sp|B6J863|SYL_COXB1 Leucine--tRNA ligase OS=Coxiella burnetii (strain CbuK_Q154) GN=leuS PE=3 SV=1 1 616 9.0E-155
sp|A1B5Q5|SYL_PARDP Leucine--tRNA ligase OS=Paracoccus denitrificans (strain Pd 1222) GN=leuS PE=3 SV=1 1 616 1.0E-154
sp|A9KCQ4|SYL_COXBN Leucine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=leuS PE=3 SV=1 1 616 1.0E-154
sp|Q83DY1|SYL_COXBU Leucine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=leuS PE=3 SV=1 1 616 1.0E-154
sp|B6J1B2|SYL_COXB2 Leucine--tRNA ligase OS=Coxiella burnetii (strain CbuG_Q212) GN=leuS PE=3 SV=1 1 616 1.0E-154
sp|Q5QYD1|SYL_IDILO Leucine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=leuS PE=3 SV=1 1 616 2.0E-154
sp|Q1GZB5|SYL_METFK Leucine--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=leuS PE=3 SV=1 1 616 2.0E-154
sp|C0QI75|SYL_DESAH Leucine--tRNA ligase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=leuS PE=3 SV=1 1 616 3.0E-154
sp|Q15VK0|SYL_PSEA6 Leucine--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=leuS PE=3 SV=1 1 616 3.0E-154
sp|Q3AF30|SYL_CARHZ Leucine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=leuS PE=3 SV=1 1 616 4.0E-154
sp|A9NC49|SYL_COXBR Leucine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=leuS PE=3 SV=1 1 616 4.0E-154
sp|Q484Q5|SYL_COLP3 Leucine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=leuS PE=3 SV=1 1 616 5.0E-154
sp|A1VEL2|SYL_DESVV Leucine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=leuS PE=3 SV=1 1 616 7.0E-154
sp|Q5RDP4|SYLM_PONAB Probable leucine--tRNA ligase, mitochondrial OS=Pongo abelii GN=LARS2 PE=2 SV=1 1 614 8.0E-154
sp|Q7W9M4|SYL_BORPA Leucine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=leuS PE=3 SV=1 1 611 8.0E-154
sp|Q72CT7|SYL_DESVH Leucine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=leuS PE=3 SV=1 1 616 9.0E-154
sp|Q01U81|SYL_SOLUE Leucine--tRNA ligase OS=Solibacter usitatus (strain Ellin6076) GN=leuS PE=3 SV=1 1 554 1.0E-153
sp|Q7WH33|SYL_BORBR Leucine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=leuS PE=3 SV=1 1 611 1.0E-153
sp|A1AV52|SYL_RUTMC Leucine--tRNA ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=leuS PE=3 SV=1 1 616 1.0E-153
sp|Q8VDC0|SYLM_MOUSE Probable leucine--tRNA ligase, mitochondrial OS=Mus musculus GN=Lars2 PE=1 SV=1 1 614 1.0E-153
sp|Q6AJZ7|SYL_DESPS Leucine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=leuS PE=3 SV=1 1 616 3.0E-153
sp|Q15031|SYLM_HUMAN Probable leucine--tRNA ligase, mitochondrial OS=Homo sapiens GN=LARS2 PE=1 SV=2 1 614 5.0E-153
sp|Q39T99|SYL_GEOMG Leucine--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=leuS PE=3 SV=1 1 616 8.0E-153
sp|B0TBJ3|SYL_HELMI Leucine--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=leuS PE=3 SV=1 1 616 1.0E-152
sp|Q7VWY7|SYL_BORPE Leucine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=leuS PE=3 SV=1 1 611 1.0E-152
sp|A5D416|SYL_PELTS Leucine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=leuS PE=3 SV=1 1 616 3.0E-152
sp|A0LK15|SYL_SYNFM Leucine--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=leuS PE=3 SV=1 1 616 3.0E-152
sp|Q5GS31|SYL_WOLTR Leucine--tRNA ligase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=leuS PE=3 SV=1 1 616 3.0E-152
sp|Q5FHG5|SYL_EHRRG Leucine--tRNA ligase OS=Ehrlichia ruminantium (strain Gardel) GN=leuS PE=3 SV=1 1 616 4.0E-152
sp|Q30YL0|SYL_DESAG Leucine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=leuS PE=3 SV=1 1 616 4.0E-152
sp|Q5PB38|SYL_ANAMM Leucine--tRNA ligase OS=Anaplasma marginale (strain St. Maries) GN=leuS PE=3 SV=1 1 616 5.0E-152
sp|A2SC91|SYL_METPP Leucine--tRNA ligase OS=Methylibium petroleiphilum (strain PM1) GN=leuS PE=3 SV=1 1 616 1.0E-151
sp|A1APS3|SYL_PELPD Leucine--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=leuS PE=3 SV=1 1 616 4.0E-151
sp|Q122Q4|SYL_POLSJ Leucine--tRNA ligase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=leuS PE=3 SV=1 1 616 4.0E-151
sp|Q5HBM8|SYL_EHRRW Leucine--tRNA ligase OS=Ehrlichia ruminantium (strain Welgevonden) GN=leuS PE=3 SV=1 1 616 4.0E-151
sp|B3PIB4|SYL_CELJU Leucine--tRNA ligase OS=Cellvibrio japonicus (strain Ueda107) GN=leuS PE=3 SV=1 1 616 5.0E-151
sp|A0JX57|SYL_ARTS2 Leucine--tRNA ligase OS=Arthrobacter sp. (strain FB24) GN=leuS PE=3 SV=1 1 554 6.0E-151
sp|A0LSY4|SYL_ACIC1 Leucine--tRNA ligase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=leuS PE=3 SV=1 1 554 6.0E-151
sp|Q182K8|SYL_PEPD6 Leucine--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=leuS PE=3 SV=1 1 616 1.0E-150
sp|A5EWD6|SYL_DICNV Leucine--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=leuS PE=3 SV=1 1 616 1.0E-150
sp|Q2KXE5|SYL_BORA1 Leucine--tRNA ligase OS=Bordetella avium (strain 197N) GN=leuS PE=3 SV=1 1 611 1.0E-150
sp|A1WGU0|SYL_VEREI Leucine--tRNA ligase OS=Verminephrobacter eiseniae (strain EF01-2) GN=leuS PE=3 SV=1 1 616 1.0E-150
sp|Q2GG41|SYL_EHRCR Leucine--tRNA ligase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=leuS PE=3 SV=1 1 616 2.0E-150
sp|B9M9F3|SYL_GEODF Leucine--tRNA ligase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=leuS PE=3 SV=1 1 616 2.0E-150
sp|A6VZE7|SYL_MARMS Leucine--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=leuS PE=3 SV=1 1 616 7.0E-150
sp|B1XXY5|SYL_LEPCP Leucine--tRNA ligase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=leuS PE=3 SV=1 1 616 7.0E-150
sp|Q16E06|SYL_ROSDO Leucine--tRNA ligase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=leuS PE=3 SV=1 1 616 7.0E-150
sp|A6T239|SYL_JANMA Leucine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=leuS PE=3 SV=1 1 616 1.0E-149
sp|Q1QV15|SYL_CHRSD Leucine--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=leuS PE=3 SV=1 1 616 4.0E-149
sp|C5CJ85|SYL_VARPS Leucine--tRNA ligase OS=Variovorax paradoxus (strain S110) GN=leuS PE=3 SV=1 1 616 6.0E-149
sp|Q21FG6|SYL_SACD2 Leucine--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=leuS PE=3 SV=1 1 616 1.0E-148
sp|A4G8E6|SYL_HERAR Leucine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=leuS PE=3 SV=1 1 616 1.0E-148
sp|B9KMH8|SYL_RHOSK Leucine--tRNA ligase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=leuS PE=3 SV=1 1 616 3.0E-148
sp|A9C1G8|SYL_DELAS Leucine--tRNA ligase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=leuS PE=3 SV=1 1 616 1.0E-147
sp|B7VKF7|SYL_VIBTL Leucine--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=leuS PE=3 SV=1 1 616 1.0E-147
sp|A9WS85|SYL_RENSM Leucine--tRNA ligase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=leuS PE=3 SV=2 1 554 1.0E-147
sp|Q47MY0|SYL_THEFY Leucine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=leuS PE=3 SV=1 1 554 2.0E-147
sp|A8F8B7|SYL_PSELT Leucine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=leuS PE=3 SV=1 1 616 2.0E-147
sp|A3PMN4|SYL_RHOS1 Leucine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=leuS PE=3 SV=1 1 616 2.0E-147
sp|Q8DFE2|SYL_VIBVU Leucine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=leuS PE=3 SV=1 1 616 3.0E-147
sp|A5CY09|SYL_VESOH Leucine--tRNA ligase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=leuS PE=3 SV=1 1 616 5.0E-147
sp|A7MY86|SYL_VIBCB Leucine--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=leuS PE=3 SV=1 1 616 7.0E-147
sp|Q3YSH6|SYL_EHRCJ Leucine--tRNA ligase OS=Ehrlichia canis (strain Jake) GN=leuS PE=3 SV=1 1 616 9.0E-147
sp|Q87RQ0|SYL_VIBPA Leucine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=leuS PE=3 SV=1 1 616 1.0E-146
sp|Q7MN06|SYL_VIBVY Leucine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=leuS PE=3 SV=1 1 616 2.0E-146
sp|A1SU60|SYL_PSYIN Leucine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=leuS PE=3 SV=1 1 616 5.0E-146
sp|Q087K2|SYL_SHEFN Leucine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=leuS PE=3 SV=2 1 616 6.0E-146
sp|A1R6X5|SYL_ARTAT Leucine--tRNA ligase OS=Arthrobacter aurescens (strain TC1) GN=leuS PE=3 SV=2 1 554 7.0E-146
sp|Q8XML8|SYL_CLOPE Leucine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=leuS PE=3 SV=1 1 616 8.0E-146
sp|Q3IZL4|SYL_RHOS4 Leucine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=leuS PE=3 SV=1 1 616 9.0E-146
sp|A1WCP8|SYL_ACISJ Leucine--tRNA ligase OS=Acidovorax sp. (strain JS42) GN=leuS PE=3 SV=1 1 616 9.0E-146
sp|A0KN87|SYL_AERHH Leucine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=leuS PE=3 SV=2 1 616 1.0E-145
sp|Q1GKN8|SYL_RUEST Leucine--tRNA ligase OS=Ruegeria sp. (strain TM1040) GN=leuS PE=3 SV=1 1 616 1.0E-145
sp|Q0SV78|SYL_CLOPS Leucine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=leuS PE=3 SV=1 1 616 1.0E-145
sp|Q8EHP4|SYL_SHEON Leucine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=leuS PE=3 SV=1 1 616 2.0E-145
sp|Q12R39|SYL_SHEDO Leucine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=leuS PE=3 SV=2 1 616 2.0E-145
sp|B0TR44|SYL_SHEHH Leucine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=leuS PE=3 SV=2 1 616 2.0E-145
sp|A0KTW7|SYL_SHESA Leucine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=leuS PE=3 SV=1 1 616 3.0E-145
sp|Q324Q2|SYL_SHIBS Leucine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=leuS PE=3 SV=1 1 616 3.0E-145
sp|A1VTV4|SYL_POLNA Leucine--tRNA ligase OS=Polaromonas naphthalenivorans (strain CJ2) GN=leuS PE=3 SV=1 1 616 3.0E-145
sp|Q0VN53|SYL_ALCBS Leucine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=leuS PE=3 SV=2 1 616 3.0E-145
sp|B1IYG6|SYL_ECOLC Leucine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=leuS PE=3 SV=1 1 616 3.0E-145
sp|B1KDW0|SYL_SHEWM Leucine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=leuS PE=3 SV=1 1 616 4.0E-145
sp|B2TU77|SYL_SHIB3 Leucine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=leuS PE=3 SV=1 1 616 4.0E-145
sp|B6I153|SYL_ECOSE Leucine--tRNA ligase OS=Escherichia coli (strain SE11) GN=leuS PE=3 SV=1 1 616 4.0E-145
sp|Q32IT9|SYL_SHIDS Leucine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=leuS PE=3 SV=1 1 616 4.0E-145
sp|P07813|SYL_ECOLI Leucine--tRNA ligase OS=Escherichia coli (strain K12) GN=leuS PE=1 SV=2 1 616 4.0E-145
sp|C4ZWC9|SYL_ECOBW Leucine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=leuS PE=3 SV=1 1 616 4.0E-145
sp|Q83LX5|SYL_SHIFL Leucine--tRNA ligase OS=Shigella flexneri GN=leuS PE=3 SV=2 1 616 4.0E-145
sp|B5YQJ4|SYL_ECO5E Leucine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=leuS PE=3 SV=1 1 616 5.0E-145
sp|Q8XBN8|SYL_ECO57 Leucine--tRNA ligase OS=Escherichia coli O157:H7 GN=leuS PE=3 SV=1 1 616 5.0E-145
sp|B7LLH1|SYL_ESCF3 Leucine--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=leuS PE=3 SV=1 1 616 5.0E-145
sp|B7M5G9|SYL_ECO8A Leucine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=leuS PE=3 SV=1 1 616 5.0E-145
sp|B7L9I6|SYL_ECO55 Leucine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=leuS PE=3 SV=1 1 616 5.0E-145
sp|A4WXA5|SYL_RHOS5 Leucine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=leuS PE=3 SV=1 1 616 5.0E-145
sp|Q0HXU4|SYL_SHESR Leucine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=leuS PE=3 SV=1 1 616 7.0E-145
sp|Q6LN98|SYL_PHOPR Leucine--tRNA ligase OS=Photobacterium profundum GN=leuS PE=3 SV=1 1 616 7.0E-145
sp|Q3Z4F0|SYL_SHISS Leucine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=leuS PE=3 SV=1 1 616 8.0E-145
sp|B7NM01|SYL_ECO7I Leucine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=leuS PE=3 SV=1 1 616 1.0E-144
sp|A8LJY0|SYL_DINSH Leucine--tRNA ligase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=leuS PE=3 SV=1 1 616 1.0E-144
sp|B9MH67|SYL_ACIET Leucine--tRNA ligase OS=Acidovorax ebreus (strain TPSY) GN=leuS PE=3 SV=1 1 616 1.0E-144
sp|B7UKT2|SYL_ECO27 Leucine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=leuS PE=3 SV=1 1 616 2.0E-144
sp|Q0HLJ0|SYL_SHESM Leucine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=leuS PE=3 SV=1 1 616 2.0E-144
sp|B1LL91|SYL_ECOSM Leucine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=leuS PE=3 SV=1 1 616 2.0E-144
sp|Q0TK31|SYL_ECOL5 Leucine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=leuS PE=3 SV=1 1 616 2.0E-144
sp|Q8FJY9|SYL_ECOL6 Leucine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=leuS PE=3 SV=2 1 616 2.0E-144
sp|B7MRS9|SYL_ECO81 Leucine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=leuS PE=3 SV=1 1 616 2.0E-144
sp|A7ZXR8|SYL_ECOHS Leucine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=leuS PE=3 SV=1 1 616 2.0E-144
sp|Q28VD4|SYL_JANSC Leucine--tRNA ligase OS=Jannaschia sp. (strain CCS1) GN=leuS PE=3 SV=1 1 616 3.0E-144
sp|A7ZJ31|SYL_ECO24 Leucine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=leuS PE=3 SV=1 1 616 3.0E-144
sp|A8AJG0|SYL_CITK8 Leucine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=leuS PE=3 SV=2 1 616 6.0E-144
sp|A4SJW8|SYL_AERS4 Leucine--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=leuS PE=3 SV=1 1 616 6.0E-144
sp|A6Q512|SYL_NITSB Leucine--tRNA ligase OS=Nitratiruptor sp. (strain SB155-2) GN=leuS PE=3 SV=1 1 616 7.0E-144
sp|B5FBK7|SYL_VIBFM Leucine--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=leuS PE=3 SV=1 1 616 7.0E-144
sp|A8H7C2|SYL_SHEPA Leucine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=leuS PE=3 SV=2 1 616 8.0E-144
sp|A6WRJ9|SYL_SHEB8 Leucine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=leuS PE=3 SV=2 1 616 9.0E-144
sp|Q1RER9|SYL_ECOUT Leucine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=leuS PE=3 SV=2 1 616 9.0E-144
sp|A1A8R7|SYL_ECOK1 Leucine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=leuS PE=3 SV=2 1 616 9.0E-144
sp|B7MFR5|SYL_ECO45 Leucine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=leuS PE=3 SV=1 1 616 9.0E-144
sp|Q0T6Q2|SYL_SHIF8 Leucine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=leuS PE=3 SV=2 1 616 1.0E-143
sp|A9L001|SYL_SHEB9 Leucine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=leuS PE=3 SV=2 1 616 2.0E-143
sp|Q5E6U8|SYL_VIBF1 Leucine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=leuS PE=3 SV=1 1 616 3.0E-143
sp|A1RGU5|SYL_SHESW Leucine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=leuS PE=3 SV=1 1 616 3.0E-143
sp|B7N9P8|SYL_ECOLU Leucine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=leuS PE=3 SV=1 1 616 3.0E-143
sp|A3QH47|SYL_SHELP Leucine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=leuS PE=3 SV=1 1 616 3.0E-143
sp|Q2NUU7|SYL_SODGM Leucine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=leuS PE=3 SV=1 1 616 4.0E-143
sp|A5F2X0|SYL_VIBC3 Leucine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=leuS PE=3 SV=2 1 616 5.0E-143
sp|B8E4X7|SYL_SHEB2 Leucine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=leuS PE=3 SV=1 1 616 5.0E-143
sp|A8FZ10|SYL_SHESH Leucine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=leuS PE=3 SV=1 1 616 5.0E-143
sp|A3D7N6|SYL_SHEB5 Leucine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=leuS PE=3 SV=2 1 616 6.0E-143
sp|B4EV14|SYL_PROMH Leucine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=leuS PE=3 SV=1 1 616 1.0E-142
sp|B6EIN2|SYL_ALISL Leucine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=leuS PE=3 SV=1 1 616 1.0E-142
sp|C5BGC7|SYL_EDWI9 Leucine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=leuS PE=3 SV=1 1 616 2.0E-142
sp|Q9KTE6|SYL_VIBCH Leucine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=leuS PE=3 SV=2 1 616 3.0E-142
sp|Q9HN72|SYL_HALSA Leucine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=leuS PE=3 SV=1 1 616 4.0E-142
sp|A5HY79|SYL_CLOBH Leucine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=leuS PE=3 SV=1 1 616 4.0E-142
sp|A7FPP5|SYL_CLOB1 Leucine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=leuS PE=3 SV=1 1 616 4.0E-142
sp|A9MKC8|SYL_SALAR Leucine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=leuS PE=3 SV=1 1 616 4.0E-142
sp|A1S8S8|SYL_SHEAM Leucine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=leuS PE=3 SV=2 1 616 5.0E-142
sp|A4Y9E9|SYL_SHEPC Leucine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=leuS PE=3 SV=1 1 616 5.0E-142
sp|B9KCS8|SYL_CAMLR Leucine--tRNA ligase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=leuS PE=3 SV=1 1 616 5.0E-142
sp|B2KB05|SYL_ELUMP Leucine--tRNA ligase OS=Elusimicrobium minutum (strain Pei191) GN=leuS PE=3 SV=1 1 616 1.0E-141
sp|A7G9T9|SYL_CLOBL Leucine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=leuS PE=3 SV=1 1 616 1.0E-141
sp|P43827|SYL_HAEIN Leucine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=leuS PE=3 SV=1 1 616 5.0E-141
sp|B2VBM4|SYL_ERWT9 Leucine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=leuS PE=3 SV=1 1 616 5.0E-141
sp|Q7N755|SYL_PHOLL Leucine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=leuS PE=3 SV=1 1 616 6.0E-141
sp|A5UI62|SYL_HAEIG Leucine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=leuS PE=3 SV=1 1 616 7.0E-141
sp|A9R6Z0|SYL_YERPG Leucine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=leuS PE=3 SV=1 1 616 7.0E-141
sp|Q66DE3|SYL_YERPS Leucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=leuS PE=3 SV=1 1 616 8.0E-141
sp|A4TNZ7|SYL_YERPP Leucine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=leuS PE=3 SV=1 1 616 8.0E-141
sp|Q1CKQ4|SYL_YERPN Leucine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=leuS PE=3 SV=1 1 616 8.0E-141
sp|Q8ZDF8|SYL_YERPE Leucine--tRNA ligase OS=Yersinia pestis GN=leuS PE=3 SV=1 1 616 8.0E-141
sp|B2K886|SYL_YERPB Leucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=leuS PE=3 SV=1 1 616 8.0E-141
sp|Q1C521|SYL_YERPA Leucine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=leuS PE=3 SV=1 1 616 8.0E-141
sp|A7FKW0|SYL_YERP3 Leucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=leuS PE=3 SV=1 1 616 8.0E-141
sp|B1JGA5|SYL_YERPY Leucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=leuS PE=3 SV=1 1 616 8.0E-141
sp|A1JQ25|SYL_YERE8 Leucine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=leuS PE=3 SV=1 1 616 2.0E-140
sp|Q0TTD0|SYL_CLOP1 Leucine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=leuS PE=3 SV=1 1 616 2.0E-140
sp|Q4QLY8|SYL_HAEI8 Leucine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=leuS PE=3 SV=1 1 616 5.0E-140
sp|Q1J0W5|SYL_DEIGD Leucine--tRNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=leuS PE=3 SV=1 1 616 6.0E-140
sp|Q3ZA07|SYL_DEHM1 Leucine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=leuS PE=3 SV=1 1 564 1.0E-139
sp|Q3ZWQ1|SYL_DEHMC Leucine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=leuS PE=3 SV=1 1 564 1.0E-139
sp|A9AZ11|SYL_HERA2 Leucine--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=leuS PE=3 SV=1 1 616 1.0E-139
sp|B0RDA6|SYL_CLAMS Leucine--tRNA ligase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=leuS PE=3 SV=1 1 554 1.0E-139
sp|A5UDF4|SYL_HAEIE Leucine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=leuS PE=3 SV=1 1 616 2.0E-139
sp|C4K7R7|SYL_HAMD5 Leucine--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=leuS PE=3 SV=1 1 616 2.0E-139
sp|A6T6A3|SYL_KLEP7 Leucine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=leuS PE=3 SV=1 1 616 3.0E-139
sp|A5FP73|SYL_DEHMB Leucine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=leuS PE=3 SV=1 1 564 5.0E-139
sp|Q7VIY7|SYL_HELHP Leucine--tRNA ligase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=leuS PE=3 SV=1 1 616 5.0E-139
sp|A5CR89|SYL_CLAM3 Leucine--tRNA ligase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=leuS PE=3 SV=1 1 554 6.0E-139
sp|Q6D7L6|SYL_PECAS Leucine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=leuS PE=3 SV=1 1 616 7.0E-139
sp|Q1AR71|SYL_RUBXD Leucine--tRNA ligase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=leuS PE=3 SV=1 1 614 7.0E-139
sp|Q5LMY0|SYL_RUEPO Leucine--tRNA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=leuS PE=3 SV=1 1 616 1.0E-138
sp|Q1LTM9|SYL_BAUCH Leucine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=leuS PE=3 SV=1 1 616 2.0E-138
sp|Q3IJ93|SYL_PSEHT Leucine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=leuS PE=3 SV=1 1 616 2.0E-138
sp|Q7M926|SYL_WOLSU Leucine--tRNA ligase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=leuS PE=3 SV=1 1 616 2.0E-138
sp|Q73K81|SYL_TREDE Leucine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=leuS PE=3 SV=1 1 616 3.0E-138
sp|B0BPF7|SYL_ACTPJ Leucine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=leuS PE=3 SV=1 1 616 3.0E-138
sp|A3N0N2|SYL_ACTP2 Leucine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=leuS PE=3 SV=1 1 616 3.0E-138
sp|P57923|SYL_PASMU Leucine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=leuS PE=3 SV=1 1 616 3.0E-138
sp|A7MQS0|SYL_CROS8 Leucine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=leuS PE=3 SV=1 1 616 4.0E-138
sp|B5XZR2|SYL_KLEP3 Leucine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=leuS PE=3 SV=1 1 616 4.0E-138
sp|Q7VM66|SYL_HAEDU Leucine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=leuS PE=3 SV=1 1 616 5.0E-138
sp|Q1CR59|SYL_HELPH Leucine--tRNA ligase OS=Helicobacter pylori (strain HPAG1) GN=leuS PE=3 SV=1 1 616 9.0E-138
sp|Q83HV5|SYL_TROW8 Leucine--tRNA ligase OS=Tropheryma whipplei (strain TW08/27) GN=leuS PE=3 SV=1 1 554 1.0E-137
sp|A8MJY6|SYL_ALKOO Leucine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=leuS PE=3 SV=1 2 616 2.0E-137
sp|Q898V2|SYL_CLOTE Leucine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=leuS PE=3 SV=1 1 614 2.0E-137
sp|B3H1L1|SYL_ACTP7 Leucine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=leuS PE=3 SV=1 1 616 3.0E-137
sp|Q9PKI4|SYL_CHLMU Leucine--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=leuS PE=3 SV=1 1 616 3.0E-137
sp|Q83GC6|SYL_TROWT Leucine--tRNA ligase OS=Tropheryma whipplei (strain Twist) GN=leuS PE=3 SV=1 1 554 3.0E-137
sp|Q9ZJ63|SYL_HELPJ Leucine--tRNA ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=leuS PE=3 SV=1 1 616 3.0E-137
sp|Q57RS7|SYL_SALCH Leucine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=leuS PE=3 SV=2 1 616 6.0E-137
sp|Q0I5C5|SYL_HAES1 Leucine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=leuS PE=3 SV=1 1 616 6.0E-137
sp|C5D6D7|SYL_GEOSW Leucine--tRNA ligase OS=Geobacillus sp. (strain WCH70) GN=leuS PE=3 SV=1 1 616 6.0E-137
sp|A8GB21|SYL_SERP5 Leucine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=leuS PE=3 SV=1 1 616 8.0E-137
sp|B4TPX5|SYL_SALSV Leucine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=leuS PE=3 SV=1 1 616 8.0E-137
sp|A9MUK3|SYL_SALPB Leucine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=leuS PE=3 SV=1 1 616 8.0E-137
sp|Q65VR5|SYL_MANSM Leucine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=leuS PE=3 SV=1 1 616 9.0E-137
sp|C0PW78|SYL_SALPC Leucine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=leuS PE=3 SV=1 1 616 1.0E-136
sp|B4SYK7|SYL_SALNS Leucine--tRNA ligase OS=Salmonella newport (strain SL254) GN=leuS PE=3 SV=1 1 616 1.0E-136
sp|B4TB51|SYL_SALHS Leucine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=leuS PE=3 SV=1 1 616 1.0E-136
sp|B5EZ89|SYL_SALA4 Leucine--tRNA ligase OS=Salmonella agona (strain SL483) GN=leuS PE=3 SV=1 1 616 1.0E-136
sp|P56457|SYL_HELPY Leucine--tRNA ligase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=leuS PE=3 SV=1 1 616 1.0E-136
sp|Q8ZQZ6|SYL_SALTY Leucine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=leuS PE=3 SV=1 1 616 1.0E-136
sp|B5FMP4|SYL_SALDC Leucine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=leuS PE=3 SV=1 1 616 1.0E-136
sp|Q8RCT6|SYL_CALS4 Leucine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=leuS PE=3 SV=1 1 614 1.0E-136
sp|A6VMB8|SYL_ACTSZ Leucine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=leuS PE=3 SV=1 1 616 1.0E-136
sp|B5R7Z6|SYL_SALG2 Leucine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=leuS PE=3 SV=1 1 616 2.0E-136
sp|B5QVP9|SYL_SALEP Leucine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=leuS PE=3 SV=1 1 616 2.0E-136
sp|A7GZ81|SYL_CAMC5 Leucine--tRNA ligase OS=Campylobacter curvus (strain 525.92) GN=leuS PE=3 SV=1 1 616 3.0E-136
sp|B0BBI9|SYL_CHLTB Leucine--tRNA ligase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=leuS PE=3 SV=1 1 616 5.0E-136
sp|B0B9V9|SYL_CHLT2 Leucine--tRNA ligase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=leuS PE=3 SV=1 1 616 5.0E-136
sp|A1SHV9|SYL_NOCSJ Leucine--tRNA ligase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=leuS PE=3 SV=1 1 554 5.0E-136
sp|Q17YZ0|SYL_HELAH Leucine--tRNA ligase OS=Helicobacter acinonychis (strain Sheeba) GN=leuS PE=3 SV=1 1 616 5.0E-136
sp|A4W827|SYL_ENT38 Leucine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=leuS PE=3 SV=1 1 616 7.0E-136
sp|B5BCE6|SYL_SALPK Leucine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=leuS PE=3 SV=1 1 616 8.0E-136
sp|Q5PM88|SYL_SALPA Leucine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=leuS PE=3 SV=1 1 616 8.0E-136
sp|C6DBW8|SYL_PECCP Leucine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=leuS PE=3 SV=1 1 616 1.0E-135
sp|Q8Z8H5|SYL_SALTI Leucine--tRNA ligase OS=Salmonella typhi GN=leuS PE=3 SV=1 1 616 1.0E-135
sp|B0URM9|SYL_HISS2 Leucine--tRNA ligase OS=Histophilus somni (strain 2336) GN=leuS PE=3 SV=1 1 616 2.0E-135
sp|Q9RSF0|SYL_DEIRA Leucine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuS PE=3 SV=2 1 616 2.0E-135
sp|Q3KMF3|SYL_CHLTA Leucine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=leuS PE=3 SV=1 1 616 3.0E-135
sp|A0PYK3|SYL_CLONN Leucine--tRNA ligase OS=Clostridium novyi (strain NT) GN=leuS PE=3 SV=1 1 616 3.0E-135
sp|P36430|SYL_BACSU Leucine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=leuS PE=3 SV=3 1 579 6.0E-135
sp|B7GK53|SYL_ANOFW Leucine--tRNA ligase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=leuS PE=3 SV=1 1 616 8.0E-135
sp|O84211|SYL_CHLTR Leucine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=leuS PE=3 SV=1 1 616 1.0E-134
sp|Q1MFI6|SYL1_RHIL3 Leucine--tRNA ligase 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=leuS1 PE=3 SV=1 1 616 2.0E-134
sp|Q97LB6|SYL_CLOAB Leucine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=leuS PE=3 SV=1 1 614 2.0E-134
sp|A4IRY3|SYL_GEOTN Leucine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=leuS PE=3 SV=2 1 616 4.0E-134
sp|Q9A1P0|SYL_STRP1 Leucine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=leuS PE=3 SV=1 1 616 5.0E-134
sp|A5N399|SYL_CLOK5 Leucine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=leuS PE=3 SV=1 1 614 5.0E-134
sp|A7GU19|SYL_BACCN Leucine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=leuS PE=3 SV=1 1 616 6.0E-134
sp|Q8CNU8|SYL_STAES Leucine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=leuS PE=3 SV=2 1 616 6.0E-134
sp|Q5HNF1|SYL_STAEQ Leucine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=leuS PE=3 SV=1 1 616 6.0E-134
sp|A6WDL7|SYL_KINRD Leucine--tRNA ligase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=leuS PE=3 SV=1 1 555 9.0E-134
sp|Q5XE35|SYL_STRP6 Leucine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=leuS PE=3 SV=1 1 616 1.0E-133
sp|A7ZE39|SYL_CAMC1 Leucine--tRNA ligase OS=Campylobacter concisus (strain 13826) GN=leuS PE=3 SV=1 1 616 1.0E-133
sp|A6M268|SYL_CLOB8 Leucine--tRNA ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=leuS PE=3 SV=1 1 616 2.0E-133
sp|Q1JIV9|SYL_STRPD Leucine--tRNA ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=leuS PE=3 SV=1 1 616 2.0E-133
sp|Q5L5Q6|SYL_CHLAB Leucine--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=leuS PE=3 SV=1 1 616 2.0E-133
sp|P0DG45|SYL_STRPQ Leucine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=leuS PE=3 SV=1 1 616 2.0E-133
sp|P0DG44|SYL_STRP3 Leucine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=leuS PE=3 SV=1 1 616 2.0E-133
sp|Q5KW09|SYL_GEOKA Leucine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=leuS PE=3 SV=1 1 616 4.0E-133
sp|A2RCB2|SYL_STRPG Leucine--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=leuS PE=3 SV=1 1 616 4.0E-133
sp|A7H2R6|SYL_CAMJD Leucine--tRNA ligase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=leuS PE=3 SV=1 1 616 4.0E-133
sp|Q7VRA6|SYL_BLOFL Leucine--tRNA ligase OS=Blochmannia floridanus GN=leuS PE=3 SV=1 1 616 5.0E-133
sp|Q8P2T2|SYL_STRP8 Leucine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=leuS PE=3 SV=1 1 616 7.0E-133
sp|Q254X5|SYL_CHLFF Leucine--tRNA ligase OS=Chlamydophila felis (strain Fe/C-56) GN=leuS PE=3 SV=1 1 616 7.0E-133
[Show less]

GO

GO Term Description Terminal node
GO:0002161 aminoacyl-tRNA editing activity Yes
GO:0005524 ATP binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0000166 nucleotide binding Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0005488 binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0044238 primary metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0008152 metabolic process No
GO:0016874 ligase activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0046483 heterocycle metabolic process No
GO:0008144 drug binding No
GO:0052689 carboxylic ester hydrolase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044281 small molecule metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0006399 tRNA metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0043039 tRNA aminoacylation No
GO:0034660 ncRNA metabolic process No
GO:0016787 hydrolase activity No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0043038 amino acid activation No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006520 cellular amino acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1554
MFPYPSGTLHLGHLRVYTIADVVARYHRLKGENVLLPMGWDAFGLPAENAALERGVRPDEWTASNIAKMKQQLEL
MNGSWNWSRELATCDPEFYKHTQKLFLMLYERGLAYQAEAEVNYDPVDKTVLANEQVDAHGCSWRSGAKVEKRML
KQWFFRISHFRDALLDHLECLARDGAWPERVIAQQKNWLGKSTGASIKFPLMSFGADVGAAIDIFTTRPETLFGV
QYIALAASHPVVARLAESDAELQAFLDTLPGLPPDSKVGYLLPQLRAVNPLAYHDDTPDATKASLPIYIAPYVLG
DYGEGAVMGVPGHDLRDHSFWRTHQKDQPVRIVLAASEDEATMAIDNEPFLQTGVMTSHSGPFKGKSSAEAGETI
LRMLEAADLAKPAEKWRLRDWLISRQRYWGAPIPIVHCEACGPVAVPDDQLPIKLPRVDQHWAEGKAGNALESSA
DFVDTECPQCGGAARRDTDTMDTFVDSSWYYARFADPHNADRLVSPEAAKDLPVDIYIGGVEHAILHLLYARFIY
KFLATTPVLAQHSNECPEPFRRLITQGMVHGKTFVDPDNGKFLQPGEVDASDPASPKVAATGRAAVVAFEKMSKS
KHNGVDPTDCIAKYRA*
Coding >Hirsu2|1554
ATGTTCCCCTATCCCTCCGGCACCCTCCATCTCGGCCACCTACGAGTCTACACCATTGCCGACGTCGTCGCCCGC
TATCATAGGCTCAAGGGCGAAAATGTCCTGCTCCCCATGGGCTGGGATGCCTTTGGCCTGCCGGCCGAGAACGCT
GCGCTCGAGAGGGGTGTCCGGCCTGACGAGTGGACGGCCAGCAACATTGCCAAGATGAAGCAGCAGCTCGAGCTC
ATGAACGGCAGCTGGAACTGGAGCCGTGAGCTGGCGACGTGCGACCCCGAATTTTATAAGCATACCCAGAAGCTG
TTCCTCATGCTTTACGAGCGCGGACTGGCCTACCAAGCCGAGGCCGAGGTCAACTACGACCCCGTTGACAAGACG
GTTCTCGCCAACGAGCAAGTCGACGCCCATGGCTGCTCTTGGAGATCGGGCGCCAAAGTGGAAAAGAGGATGCTG
AAGCAGTGGTTCTTCCGCATATCCCACTTCCGAGACGCCCTCCTCGACCACCTCGAGTGTCTGGCCCGAGACGGC
GCGTGGCCCGAGCGCGTCATCGCCCAGCAGAAGAATTGGCTGGGCAAGTCGACCGGGGCCTCCATCAAGTTTCCG
CTCATGTCTTTCGGCGCCGACGTCGGGGCCGCCATCGACATCTTCACCACGCGGCCAGAAACGCTGTTTGGGGTG
CAGTACATCGCCCTTGCCGCTTCCCATCCGGTCGTGGCCCGGCTCGCGGAGAGCGACGCAGAGCTGCAGGCCTTC
CTGGACACCCTGCCCGGCTTGCCCCCCGACTCCAAGGTCGGCTACCTCTTGCCCCAGCTGCGCGCCGTCAATCCC
CTCGCCTACCACGACGACACCCCGGATGCGACCAAGGCCTCGCTCCCCATCTACATCGCGCCATACGTGCTGGGC
GATTATGGCGAAGGAGCCGTCATGGGCGTGCCGGGCCACGACCTGCGCGACCACTCCTTCTGGCGCACGCACCAG
AAAGACCAGCCCGTGCGCATTGTGCTGGCCGCCTCGGAGGACGAGGCCACCATGGCCATCGACAACGAACCCTTT
CTCCAGACCGGCGTCATGACGAGCCACAGCGGTCCCTTCAAGGGTAAGTCCTCGGCCGAGGCCGGCGAGACGATT
TTGCGCATGCTCGAGGCCGCGGACCTGGCCAAGCCTGCCGAGAAATGGCGACTCCGCGACTGGCTCATCAGCCGC
CAGCGGTACTGGGGCGCCCCGATCCCCATTGTCCACTGCGAAGCGTGCGGGCCCGTCGCGGTACCGGACGACCAG
CTACCGATCAAGCTGCCCCGGGTCGACCAGCACTGGGCCGAGGGCAAGGCGGGCAACGCCCTGGAGTCGTCGGCC
GACTTCGTCGACACCGAGTGCCCCCAGTGCGGCGGCGCCGCCCGCCGAGACACTGACACAATGGACACGTTTGTG
GACTCAAGCTGGTACTACGCCCGCTTCGCCGACCCGCACAATGCGGACCGGCTCGTGTCGCCCGAGGCAGCCAAG
GACCTGCCCGTCGACATCTACATCGGTGGCGTCGAGCACGCCATCCTCCACCTTCTCTATGCCCGCTTCATCTAC
AAGTTCCTCGCGACGACGCCCGTACTGGCCCAGCACTCAAACGAGTGTCCCGAGCCCTTCCGGCGCCTGATCACG
CAAGGCATGGTGCACGGCAAGACGTTCGTCGATCCGGACAACGGCAAGTTCCTCCAGCCCGGCGAGGTGGACGCC
TCGGACCCCGCGTCGCCCAAGGTGGCGGCCACGGGGAGGGCGGCGGTGGTGGCGTTCGAGAAGATGTCCAAGTCG
AAGCACAACGGCGTGGATCCGACGGACTGCATAGCCAAATATCGGGCGTGA
Transcript >Hirsu2|1554
ATGTTCCCCTATCCCTCCGGCACCCTCCATCTCGGCCACCTACGAGTCTACACCATTGCCGACGTCGTCGCCCGC
TATCATAGGCTCAAGGGCGAAAATGTCCTGCTCCCCATGGGCTGGGATGCCTTTGGCCTGCCGGCCGAGAACGCT
GCGCTCGAGAGGGGTGTCCGGCCTGACGAGTGGACGGCCAGCAACATTGCCAAGATGAAGCAGCAGCTCGAGCTC
ATGAACGGCAGCTGGAACTGGAGCCGTGAGCTGGCGACGTGCGACCCCGAATTTTATAAGCATACCCAGAAGCTG
TTCCTCATGCTTTACGAGCGCGGACTGGCCTACCAAGCCGAGGCCGAGGTCAACTACGACCCCGTTGACAAGACG
GTTCTCGCCAACGAGCAAGTCGACGCCCATGGCTGCTCTTGGAGATCGGGCGCCAAAGTGGAAAAGAGGATGCTG
AAGCAGTGGTTCTTCCGCATATCCCACTTCCGAGACGCCCTCCTCGACCACCTCGAGTGTCTGGCCCGAGACGGC
GCGTGGCCCGAGCGCGTCATCGCCCAGCAGAAGAATTGGCTGGGCAAGTCGACCGGGGCCTCCATCAAGTTTCCG
CTCATGTCTTTCGGCGCCGACGTCGGGGCCGCCATCGACATCTTCACCACGCGGCCAGAAACGCTGTTTGGGGTG
CAGTACATCGCCCTTGCCGCTTCCCATCCGGTCGTGGCCCGGCTCGCGGAGAGCGACGCAGAGCTGCAGGCCTTC
CTGGACACCCTGCCCGGCTTGCCCCCCGACTCCAAGGTCGGCTACCTCTTGCCCCAGCTGCGCGCCGTCAATCCC
CTCGCCTACCACGACGACACCCCGGATGCGACCAAGGCCTCGCTCCCCATCTACATCGCGCCATACGTGCTGGGC
GATTATGGCGAAGGAGCCGTCATGGGCGTGCCGGGCCACGACCTGCGCGACCACTCCTTCTGGCGCACGCACCAG
AAAGACCAGCCCGTGCGCATTGTGCTGGCCGCCTCGGAGGACGAGGCCACCATGGCCATCGACAACGAACCCTTT
CTCCAGACCGGCGTCATGACGAGCCACAGCGGTCCCTTCAAGGGTAAGTCCTCGGCCGAGGCCGGCGAGACGATT
TTGCGCATGCTCGAGGCCGCGGACCTGGCCAAGCCTGCCGAGAAATGGCGACTCCGCGACTGGCTCATCAGCCGC
CAGCGGTACTGGGGCGCCCCGATCCCCATTGTCCACTGCGAAGCGTGCGGGCCCGTCGCGGTACCGGACGACCAG
CTACCGATCAAGCTGCCCCGGGTCGACCAGCACTGGGCCGAGGGCAAGGCGGGCAACGCCCTGGAGTCGTCGGCC
GACTTCGTCGACACCGAGTGCCCCCAGTGCGGCGGCGCCGCCCGCCGAGACACTGACACAATGGACACGTTTGTG
GACTCAAGCTGGTACTACGCCCGCTTCGCCGACCCGCACAATGCGGACCGGCTCGTGTCGCCCGAGGCAGCCAAG
GACCTGCCCGTCGACATCTACATCGGTGGCGTCGAGCACGCCATCCTCCACCTTCTCTATGCCCGCTTCATCTAC
AAGTTCCTCGCGACGACGCCCGTACTGGCCCAGCACTCAAACGAGTGTCCCGAGCCCTTCCGGCGCCTGATCACG
CAAGGCATGGTGCACGGCAAGACGTTCGTCGATCCGGACAACGGCAAGTTCCTCCAGCCCGGCGAGGTGGACGCC
TCGGACCCCGCGTCGCCCAAGGTGGCGGCCACGGGGAGGGCGGCGGTGGTGGCGTTCGAGAAGATGTCCAAGTCG
AAGCACAACGGCGTGGATCCGACGGACTGCATAGCCAAATATCGGGCGTGA
Gene >Hirsu2|1554
ATGTTCCCCTATCCCTCCGGCACCCTCCATCTCGGCCACCTACGAGTCTACACCATTGCCGACGTCGTCGCCCGC
TATCATAGGCTCAAGGGCGAAAATGTCCTGCTCCCCATGGGCTGGGATGCCTTTGGCCTGCCGGCCGAGAACGCT
GCGCTCGAGAGGGGTGTCCGGCCTGACGAGTGGACGGCCAGCAACATTGCCAAGATGAAGCAGCAGCTCGAGCTC
ATGAACGGCAGCTGGAACTGGAGCCGTGTCAGTCGTCCCGCAGCCTATTACCCGTCGTCTCCCTCTGCGCTAAAT
CCCTGTTCCAGGAGCTGGCGACGTGCGACCCCGAATTTTATAAGCATACCCAGAAGCTGTTCCTCATGCTTTACG
AGCGCGGACTGGCCTACCAAGCCGAGGCCGAGGTCAACTACGACCCCGTTGACAAGACGGTTCTCGCCAACGAGC
AAGTCGACGCCCATGGCTGCTCTTGGAGATCGGGCGCCAAAGTGGAAAAGAGGATGCTGAAGCAGTGGTTCTTCC
GCATATCCCACTTCCGAGACGCCCTCCTCGACCACCTCGAGTGTCTGGCCCGAGACGGCGCGTGGCCCGAGCGCG
TCATCGCCCAGCAGAAGAATTGGCTGGGCAAGTCGACCGGGGCCTCCATCAAGTTTCCGCTCATGTCTTTCGGCG
CCGACGTCGGGGCCGCCATCGACATCTTCACCACGCGGCCAGAAACGCTGTTTGGGGTGCAGTACATCGCCCTTG
CCGCTTCCCATCCGGTCGTGGCCCGGCTCGCGGAGAGCGACGCAGAGCTGCAGGCCTTCCTGGACACCCTGCCCG
GCTTGCCCCCCGACTCCAAGGTCGGCTACCTCTTGCCCCAGCTGCGCGCCGTCAATCCCCTCGCCTACCACGACG
ACACCCCGGATGCGACCAAGGCCTCGCTCCCCATCTACATCGCGCCATACGTGCTGGGCGATTATGGCGAAGGAG
CCGTCATGGGCGTGCCGGGCCACGACCTGCGCGACCACTCCTTCTGGCGCACGCACCAGAAAGACCAGCCCGTGC
GCATTGTGCTGGCCGCCTCGGAGGACGAGGCCACCATGGCCATCGACAACGAACCCTTTCTCCAGACCGGCGTCA
TGACGAGCCACAGCGGTCCCTTCAAGGGTAAGTCCTCGGCCGAGGCCGGCGAGACGATTTTGCGCATGCTCGAGG
CCGCGGACCTGGCCAAGCCTGCCGAGAAATGGCGACTCCGCGACTGGCTCATCAGCCGCCAGCGGTACTGGGGCG
CCCCGATCCCCATTGTCCACTGCGAAGCGTGCGGGCCCGTCGCGGTACCGGACGACCAGCTACCGATCAAGCTGC
CCCGGGTCGACCAGCACTGGGCCGAGGGCAAGGCGGGCAACGCCCTGGAGTCGTCGGCCGACTTCGTCGACACCG
AGTGCCCCCAGTGCGGCGGCGCCGCCCGCCGAGACACTGACACAATGGACACGTTTGTGGACTCAAGCTGGTACT
ACGCCCGCTTCGCCGACCCGCACAATGCGGACCGGCTCGTGTCGCCCGAGGCAGCCAAGGACCTGCCCGTCGACA
TCTACATCGGTGGCGTCGAGCACGCCATCCTCCACCTTCTCTATGCCCGCTTCATCTACAAGTTCCTCGCGACGA
CGCCCGTACTGGCCCAGCACTCAAACGAGTGTCCCGAGCCCTTCCGGCGCCTGATCACGCAAGGCATGGTGCACG
GCAAGACGTTCGTCGATCCGGACAACGGCAAGTTCCTCCAGCCCGGCGAGGTGGACGCCTCGGACCCCGCGTCGC
CCAAGGTGGCGGCCACGGGGAGGGCGGCGGTGGTGGCGTTCGAGAAGATGTCCAAGTCGAAGCACAACGGCGTGG
ATCCGACGGACTGCATAGCCAAGTACGGCGCGGACGCGACGAGGGCCCACATGCTGTTCCAGGCGCCGGTGGCAG
AGGTGCTGAACTGGGACGAGAGCAAGATATCGGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail