Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1544
Gene name
LocationContig_1343:4913..6583
Strand-
Gene length (bp)1670
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 2.7E-22 99 263
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 2.2E-24 299 440

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 50 454 3.0E-119
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 68 443 7.0E-118
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 81 443 2.0E-93
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 70 450 2.0E-88
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 70 440 3.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 50 454 3.0E-119
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 68 443 7.0E-118
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 81 443 2.0E-93
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 70 450 2.0E-88
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 70 440 3.0E-86
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 81 444 4.0E-86
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 70 450 7.0E-85
sp|Q93Z81|CAX3_ARATH Vacuolar cation/proton exchanger 3 OS=Arabidopsis thaliana GN=CAX3 PE=1 SV=1 47 445 3.0E-83
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 52 440 1.0E-81
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 70 440 2.0E-81
sp|Q39253|CAX1_ARATH Vacuolar cation/proton exchanger 1 OS=Arabidopsis thaliana GN=CAX1 PE=1 SV=3 73 440 5.0E-79
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 46 442 4.0E-77
sp|Q5TKG3|CAX1B_ORYSJ Vacuolar cation/proton exchanger 1b OS=Oryza sativa subsp. japonica GN=CAX1b PE=2 SV=1 85 440 9.0E-75
sp|Q769E5|CAX1A_ORYSJ Vacuolar cation/proton exchanger 1a OS=Oryza sativa subsp. japonica GN=CAX1a PE=1 SV=1 22 452 5.0E-73
sp|Q6YXZ1|CAX4_ORYSJ Putative vacuolar cation/proton exchanger 4 OS=Oryza sativa subsp. japonica GN=Os02g0138900 PE=3 SV=1 70 440 1.0E-71
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 76 440 5.0E-65
sp|Q5KTQ9|CAX1C_ORYSJ Vacuolar cation/proton exchanger 1c OS=Oryza sativa subsp. japonica GN=CAX1c PE=2 SV=1 81 440 8.0E-58
sp|P42839|VNX1_YEAST Low affinity vacuolar monovalent cation/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VNX1 PE=1 SV=1 66 440 5.0E-34
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 63 287 4.0E-14
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 274 439 4.0E-14
sp|P55471|Y4HA_RHISN Putative ionic transporter y4hA OS=Rhizobium sp. (strain NGR234) GN=NGR_a03490 PE=3 SV=1 121 434 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 73 95 22
2 99 118 19
3 130 152 22
4 167 186 19
5 207 229 22
6 239 261 22
7 294 316 22
8 331 353 22
9 366 388 22
10 398 415 17
11 422 444 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1544
MNNKQSRGADESTPLVGAQVASSAAPNGVGAASSDRSDAFIFFFDTRQTPGRESRSVAVRSLAHTWHVTKVTILS
NYVNFLLVTVPIGIAAGAFHWSPTAVFTINFFAIIPLAAVLSFATEEISMKLGETLGGLLNATFGNAVELIVSIV
ALKDGQIQVVQASMLGSILSNLLLVMGMCFFFGGIVHRGETGRGTEQNFSSAVAQTTCSLMTLSSASLVIPAALY
AVLSQNGSQEKNQSILVLSRGTAIILLLLYVLYLVFQLRTHSNLFDAEDQADSQAGDDDEQDETPCMGALAAGIV
LVVVTVLVAVCAEYLVGSIDDIVESAGISKAFIGLILIPIVGNAAEHVTAVVVALRDKMDLAMGVAIGSSIQIAL
GVTPFLVIVGWIIGQDMTLHFDTFQTVAFAVSVLVVTYTVQDGKSNYLEGAMLLGLYVIIAVAFYASPTDAMDKV
TNMLGRA*
Coding >Hirsu2|1544
ATGAACAACAAGCAGAGCCGCGGCGCGGACGAGAGCACGCCCTTGGTCGGCGCCCAGGTGGCCTCGTCGGCGGCG
CCCAACGGCGTCGGCGCCGCCTCGTCGGACCGCTCCGACGCCTTCATCTTCTTCTTCGACACGCGCCAGACGCCC
GGCCGCGAGAGCCGCAGCGTCGCCGTCCGCAGCCTCGCCCACACCTGGCACGTCACCAAGGTCACCATCCTCAGC
AACTATGTCAACTTCCTGCTCGTCACCGTGCCCATCGGCATCGCCGCCGGGGCCTTCCACTGGTCGCCGACGGCC
GTCTTCACCATCAACTTCTTCGCCATCATCCCCCTCGCCGCCGTCCTCTCCTTCGCCACCGAGGAGATCTCGATG
AAGCTCGGCGAGACGCTGGGCGGCCTCCTCAACGCCACCTTTGGCAACGCCGTTGAATTGATTGTCAGCATCGTC
GCGCTCAAGGACGGCCAGATCCAGGTCGTGCAGGCCTCGATGCTCGGCTCCATCCTGTCCAACCTGCTGCTCGTC
ATGGGCATGTGCTTCTTCTTCGGCGGCATCGTCCATCGCGGCGAGACGGGCCGCGGCACCGAGCAGAACTTCTCC
TCCGCCGTCGCCCAGACGACCTGCTCGCTCATGACGCTCTCGTCCGCCTCGCTCGTCATCCCCGCCGCCCTGTAC
GCGGTCCTGAGCCAGAACGGGTCGCAGGAGAAGAACCAGAGCATCCTGGTGCTGTCGCGCGGCACGGCCATCATC
CTCCTCCTTCTCTACGTCCTCTACCTCGTCTTCCAGCTGCGCACCCACAGCAACCTCTTCGACGCCGAGGACCAG
GCCGACAGCCAGGCGGGCGACGACGACGAGCAGGACGAGACGCCCTGCATGGGCGCCCTGGCCGCCGGCATCGTC
CTCGTCGTCGTCACCGTCCTCGTCGCCGTCTGCGCCGAGTACCTGGTCGGCAGCATCGACGACATTGTCGAGAGC
GCCGGCATCAGCAAGGCCTTCATCGGCCTGATCCTCATCCCCATCGTCGGCAACGCCGCCGAGCACGTCACCGCC
GTCGTCGTCGCCCTGCGCGACAAGATGGACCTGGCCATGGGCGTCGCCATCGGCTCCTCCATCCAGATCGCCCTC
GGCGTCACCCCCTTCCTCGTCATCGTCGGCTGGATCATCGGCCAGGACATGACGCTGCACTTTGACACTTTCCAA
ACCGTCGCCTTCGCCGTCTCGGTCCTGGTCGTCACCTACACCGTCCAGGACGGCAAGTCCAACTACCTCGAGGGC
GCCATGCTCCTCGGCCTCTACGTCATCATCGCCGTCGCCTTCTACGCCAGCCCCACCGACGCCATGGACAAGGTT
ACCAACATGCTGGGCCGCGCCTGA
Transcript >Hirsu2|1544
ATGAACAACAAGCAGAGCCGCGGCGCGGACGAGAGCACGCCCTTGGTCGGCGCCCAGGTGGCCTCGTCGGCGGCG
CCCAACGGCGTCGGCGCCGCCTCGTCGGACCGCTCCGACGCCTTCATCTTCTTCTTCGACACGCGCCAGACGCCC
GGCCGCGAGAGCCGCAGCGTCGCCGTCCGCAGCCTCGCCCACACCTGGCACGTCACCAAGGTCACCATCCTCAGC
AACTATGTCAACTTCCTGCTCGTCACCGTGCCCATCGGCATCGCCGCCGGGGCCTTCCACTGGTCGCCGACGGCC
GTCTTCACCATCAACTTCTTCGCCATCATCCCCCTCGCCGCCGTCCTCTCCTTCGCCACCGAGGAGATCTCGATG
AAGCTCGGCGAGACGCTGGGCGGCCTCCTCAACGCCACCTTTGGCAACGCCGTTGAATTGATTGTCAGCATCGTC
GCGCTCAAGGACGGCCAGATCCAGGTCGTGCAGGCCTCGATGCTCGGCTCCATCCTGTCCAACCTGCTGCTCGTC
ATGGGCATGTGCTTCTTCTTCGGCGGCATCGTCCATCGCGGCGAGACGGGCCGCGGCACCGAGCAGAACTTCTCC
TCCGCCGTCGCCCAGACGACCTGCTCGCTCATGACGCTCTCGTCCGCCTCGCTCGTCATCCCCGCCGCCCTGTAC
GCGGTCCTGAGCCAGAACGGGTCGCAGGAGAAGAACCAGAGCATCCTGGTGCTGTCGCGCGGCACGGCCATCATC
CTCCTCCTTCTCTACGTCCTCTACCTCGTCTTCCAGCTGCGCACCCACAGCAACCTCTTCGACGCCGAGGACCAG
GCCGACAGCCAGGCGGGCGACGACGACGAGCAGGACGAGACGCCCTGCATGGGCGCCCTGGCCGCCGGCATCGTC
CTCGTCGTCGTCACCGTCCTCGTCGCCGTCTGCGCCGAGTACCTGGTCGGCAGCATCGACGACATTGTCGAGAGC
GCCGGCATCAGCAAGGCCTTCATCGGCCTGATCCTCATCCCCATCGTCGGCAACGCCGCCGAGCACGTCACCGCC
GTCGTCGTCGCCCTGCGCGACAAGATGGACCTGGCCATGGGCGTCGCCATCGGCTCCTCCATCCAGATCGCCCTC
GGCGTCACCCCCTTCCTCGTCATCGTCGGCTGGATCATCGGCCAGGACATGACGCTGCACTTTGACACTTTCCAA
ACCGTCGCCTTCGCCGTCTCGGTCCTGGTCGTCACCTACACCGTCCAGGACGGCAAGTCCAACTACCTCGAGGGC
GCCATGCTCCTCGGCCTCTACGTCATCATCGCCGTCGCCTTCTACGCCAGCCCCACCGACGCCATGGACAAGGTT
ACCAACATGCTGGGCCGCGCCTGA
Gene >Hirsu2|1544
ATGAACAACAAGCAGAGCCGCGGCGCGGACGAGAGCACGCCCTTGGTCGGCGCCCAGGTGGCCTCGTCGGCGGCG
CCCAACGGCGTCGGCGCCGCCTCGTCGGACCGCTCCGACGCCTTCATCTTCTTCTTCGACACGCGCCAGACGCCC
GGCCGCGAGAGCCGCAGCGTCGCCGTCCGCAGCCTCGCCCACACCTGGCACGTCACCAAGGTCACCATCCTCAGC
AGTACGTCGTTGCCCTGCCCTGCCCTGCCTTGACGTCCCTTTGCTTCGGGGAGAGGGCCGGCCGACTGACAGCGG
CGCAGACTATGTCAACTTCCTGCTCGTCACCGTGCCCATCGGCATCGCCGCCGGGGCCTTCCACTGGTCGCCGAC
GGCCGTCTTCACCATCAACTTCTTCGCCATCATCCCCCTCGCCGCCGTCCTCTCCTTCGCCACCGAGGAGATCTC
GATGAAGCTCGGCGAGACGCTGGGCGGCCTCCTCAACGCCACCTTTGGCAACGCCGTTGAATTGATTGTATTGCC
CCCCCCCCCTCCTCCCCTTCTGCCCGTCACCCTGGCGCCGCGCTCACCCGTCGTCCACAGGTCAGCATCGTCGCG
CTCAAGGACGGCCAGATCCAGGTCGTGCAGGCCTCGATGCTCGGCTCCATCCTGTCCAACCTGCTGCTCGTCATG
GGCATGTGCTTCTTCTTCGGCGGCATCGTCCATCGCGGCGAGACGGGCCGCGGCACCGAGCAGAACTTCTCCTCC
GCCGTCGCCCAGACGACCTGCTCGCTCATGACGCTCTCGTCCGCCTCGCTCGTCATCCCCGCCGCCGTGAGTTCC
CTCCTCTCTTGCGCTCGCGTCCCCGCCGTCCCCCCCTGTGCTGAAACCCGTTGCCGCAGCTGTACGCGGTCCTGA
GCCAGAACGGGTCGCAGGAGAAGAACCAGAGCATCCTGGTGCTGTCGCGCGGCACGGCCATCATCCTCCTCCTTC
TCTACGTCCTCTACCTCGTCTTCCAGCTGCGCACCCACAGCAACCTCTTCGACGCCGAGGACCAGGCCGACAGCC
AGGCGGGCGACGACGACGAGCAGGACGAGACGCCCTGCATGGGCGCCCTGGCCGCCGGCATCGTCCTCGTCGTCG
TCACCGTCCTCGTCGCCGTCTGCGCCGAGTACCTGGTCGGCAGCATCGACGACATTGTCGAGAGCGCCGGCATCA
GCAAGGCCTTCATCGGCCTGATCCTCATCCCCATCGTCGGCAACGCCGCCGAGCACGTCACCGCCGTCGTCGTCG
CCCTGCGCGACAAGATGGACCTGGCCATGGGCGTCGCCATCGGCTCCTCCATCCAGATCGCCCTCGGCGTCACCC
CCTTCCTCGTCATCGTCGGCTGGATCATCGGCCAGGACATGACGCTGCACTTTGACACTTGTACGTCTTGCCTCC
CCATCCCCCTCCCCCCATCTCAACAAGGGCACCGAGCCGGGCCGCTGACCGCGTGTGAAATGCCAGTCCAAACCG
TCGCCTTCGCCGTCTCGGTCCTGGTCGTCACCTACACCGTCCAGGACGGCAAGTCCAACTACCTCGAGGGCGCCA
TGCTCCTCGGCCTCTACGTCATCATCGCCGTCGCCTTCTACGCCAGCCCCACCGACGCCATGGACAAGGTTACCA
ACATGCTGGGCCGCGCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail