Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1542
Gene name
LocationContig_1343:398..908
Strand-
Gene length (bp)510
Transcript length (bp)378
Coding sequence length (bp)378
Protein length (aa) 126

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02628 COX15-CtaA Cytochrome oxidase assembly protein 2.8E-15 82 124

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40086|COX15_YEAST Cytochrome c oxidase assembly protein COX15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX15 PE=3 SV=1 33 124 3.0E-18
sp|A7HXA1|CTAA_PARL1 Heme A synthase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=ctaA PE=3 SV=1 75 124 1.0E-14
sp|Q10361|ETP1_SCHPO Electron transfer protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=etp1 PE=1 SV=2 79 124 2.0E-14
sp|B6IUZ7|CTAA_RHOCS Heme A synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=ctaA PE=3 SV=1 78 124 2.0E-12
sp|A5VF68|CTAA_SPHWW Heme A synthase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=ctaA PE=3 SV=2 74 124 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40086|COX15_YEAST Cytochrome c oxidase assembly protein COX15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX15 PE=3 SV=1 33 124 3.0E-18
sp|A7HXA1|CTAA_PARL1 Heme A synthase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=ctaA PE=3 SV=1 75 124 1.0E-14
sp|Q10361|ETP1_SCHPO Electron transfer protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=etp1 PE=1 SV=2 79 124 2.0E-14
sp|B6IUZ7|CTAA_RHOCS Heme A synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=ctaA PE=3 SV=1 78 124 2.0E-12
sp|A5VF68|CTAA_SPHWW Heme A synthase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=ctaA PE=3 SV=2 74 124 1.0E-11
sp|A8I7Y5|CTAA_AZOC5 Heme A synthase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=ctaA PE=3 SV=1 77 124 1.0E-11
sp|B2IH44|CTAA_BEII9 Heme A synthase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=ctaA PE=3 SV=1 79 124 1.0E-11
sp|B9KW13|CTAA_RHOSK Heme A synthase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ctaA PE=3 SV=1 79 124 3.0E-11
sp|A4WZ55|CTAA_RHOS5 Heme A synthase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ctaA PE=3 SV=1 79 124 5.0E-11
sp|A3PQK0|CTAA_RHOS1 Heme A synthase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ctaA PE=3 SV=1 79 124 8.0E-11
sp|Q3IXW9|CTAA_RHOS4 Heme A synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ctaA PE=1 SV=1 79 124 8.0E-11
sp|Q82X64|CTAA_NITEU Heme A synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ctaA PE=3 SV=2 66 124 8.0E-11
sp|Q9A8H9|CTAA_CAUCR Heme A synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=ctaA PE=3 SV=1 81 124 1.0E-10
sp|B8H551|CTAA_CAUCN Heme A synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=ctaA PE=3 SV=1 81 124 1.0E-10
sp|A7ING5|CTAA_XANP2 Heme A synthase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=ctaA PE=3 SV=1 81 124 1.0E-10
sp|B3QKF4|CTAA_RHOPT Heme A synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=ctaA PE=3 SV=1 74 124 3.0E-10
sp|Q3SSR2|CTAA_NITWN Heme A synthase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ctaA PE=3 SV=1 74 125 3.0E-10
sp|B0T0S6|CTAA_CAUSK Heme A synthase OS=Caulobacter sp. (strain K31) GN=ctaA PE=3 SV=1 81 124 9.0E-10
sp|Q1RJX8|CTAA_RICBR Heme A synthase OS=Rickettsia bellii (strain RML369-C) GN=ctaA PE=3 SV=1 79 123 1.0E-09
sp|A8GXM1|CTAA_RICB8 Heme A synthase OS=Rickettsia bellii (strain OSU 85-389) GN=ctaA PE=3 SV=2 79 123 1.0E-09
sp|Q165T0|CTAA_ROSDO Heme A synthase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ctaA PE=3 SV=1 79 125 1.0E-09
sp|Q0BZT0|CTAA_HYPNA Heme A synthase OS=Hyphomonas neptunium (strain ATCC 15444) GN=ctaA PE=3 SV=1 84 125 1.0E-09
sp|Q0AIG6|CTAA_NITEC Heme A synthase OS=Nitrosomonas eutropha (strain C91) GN=ctaA PE=3 SV=1 81 124 1.0E-09
sp|Q6N660|CTAA_RHOPA Heme A synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ctaA PE=3 SV=1 74 125 2.0E-09
sp|Q2Y9R4|CTAA_NITMU Heme A synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ctaA PE=3 SV=1 79 124 2.0E-09
sp|Q0APH6|CTAA_MARMM Heme A synthase OS=Maricaulis maris (strain MCS10) GN=ctaA PE=3 SV=1 76 124 2.0E-09
sp|Q89KD9|CTAA_BRADU Heme A synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ctaA PE=3 SV=1 69 125 2.0E-09
sp|Q4UKQ2|CTAA_RICFE Heme A synthase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ctaA PE=3 SV=1 84 123 2.0E-09
sp|Q2G350|CTAA_NOVAD Heme A synthase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=ctaA PE=3 SV=1 81 124 3.0E-09
sp|Q5LRS1|CTAA_RUEPO Heme A synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ctaA PE=3 SV=2 84 125 3.0E-09
sp|A8GMQ9|CTAA_RICAH Heme A synthase OS=Rickettsia akari (strain Hartford) GN=ctaA PE=3 SV=2 84 123 4.0E-09
sp|Q1QKJ7|CTAA_NITHX Heme A synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ctaA PE=3 SV=2 79 125 4.0E-09
sp|Q9FKT8|COX15_ARATH Cytochrome c oxidase assembly protein COX15 OS=Arabidopsis thaliana GN=COX15 PE=2 SV=1 79 125 4.0E-09
sp|A8EY08|CTAA_RICCK Heme A synthase OS=Rickettsia canadensis (strain McKiel) GN=ctaA PE=3 SV=2 84 124 6.0E-09
sp|B8ISP2|CTAA_METNO Heme A synthase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=ctaA PE=3 SV=1 84 125 9.0E-09
sp|Q73HV8|CTAA_WOLPM Heme A synthase OS=Wolbachia pipientis wMel GN=ctaA PE=3 SV=1 73 124 1.0E-08
sp|Q2IWP3|CTAA_RHOP2 Heme A synthase OS=Rhodopseudomonas palustris (strain HaA2) GN=ctaA PE=3 SV=1 79 125 1.0E-08
sp|Q2GLK1|CTAA_ANAPZ Heme A synthase OS=Anaplasma phagocytophilum (strain HZ) GN=ctaA PE=3 SV=1 81 124 1.0E-08
sp|A8F119|CTAA_RICM5 Heme A synthase OS=Rickettsia massiliae (strain Mtu5) GN=ctaA PE=3 SV=2 84 123 1.0E-08
sp|C3PMV5|CTAA_RICAE Heme A synthase OS=Rickettsia africae (strain ESF-5) GN=ctaA PE=3 SV=1 84 123 1.0E-08
sp|C0R5T8|CTAA_WOLWR Heme A synthase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=ctaA PE=3 SV=1 79 124 2.0E-08
sp|Q1GGZ8|CTAA_RUEST Heme A synthase OS=Ruegeria sp. (strain TM1040) GN=ctaA PE=3 SV=1 84 125 2.0E-08
sp|Q5HAH7|CTAA_EHRRW Heme A synthase OS=Ehrlichia ruminantium (strain Welgevonden) GN=ctaA PE=3 SV=2 75 124 2.0E-08
sp|Q5FG54|CTAA_EHRRG Heme A synthase OS=Ehrlichia ruminantium (strain Gardel) GN=ctaA PE=3 SV=2 75 124 3.0E-08
sp|Q92IS7|CTAA_RICCN Heme A synthase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ctaA PE=3 SV=1 84 123 3.0E-08
sp|Q11J69|CTAA_CHESB Heme A synthase OS=Chelativorans sp. (strain BNC1) GN=ctaA PE=3 SV=1 81 124 3.0E-08
sp|B3CLF8|CTAA_WOLPP Heme A synthase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=ctaA PE=3 SV=1 79 124 3.0E-08
sp|C3MA28|CTAA_RHISN Heme A synthase OS=Rhizobium sp. (strain NGR234) GN=ctaA PE=3 SV=1 50 124 3.0E-08
sp|A8GRD0|CTAA_RICRS Heme A synthase OS=Rickettsia rickettsii (strain Sheila Smith) GN=ctaA PE=3 SV=2 84 123 3.0E-08
sp|B0BWT1|CTAA_RICRO Heme A synthase OS=Rickettsia rickettsii (strain Iowa) GN=ctaA PE=3 SV=1 84 123 3.0E-08
sp|Q92QR8|CTAA_RHIME Heme A synthase OS=Rhizobium meliloti (strain 1021) GN=ctaA PE=3 SV=1 75 124 4.0E-08
sp|Q2GHG8|CTAA_EHRCR Heme A synthase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=ctaA PE=3 SV=1 80 124 4.0E-08
sp|Q2GCS4|CTAA_NEOSM Heme A synthase OS=Neorickettsia sennetsu (strain Miyayama) GN=ctaA PE=3 SV=1 84 124 4.0E-08
sp|B9KHM9|CTAA_ANAMF Heme A synthase OS=Anaplasma marginale (strain Florida) GN=ctaA PE=3 SV=1 80 124 5.0E-08
sp|Q5PBP7|CTAA_ANAMM Heme A synthase OS=Anaplasma marginale (strain St. Maries) GN=ctaA PE=3 SV=1 80 124 5.0E-08
sp|A6U7T3|CTAA_SINMW Heme A synthase OS=Sinorhizobium medicae (strain WSM419) GN=ctaA PE=3 SV=1 75 124 7.0E-08
sp|Q8G1D1|CTAA_BRUSU Heme A synthase OS=Brucella suis biovar 1 (strain 1330) GN=ctaA PE=3 SV=1 81 124 7.0E-08
sp|A5VPX0|CTAA_BRUO2 Heme A synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=ctaA PE=3 SV=2 81 124 7.0E-08
sp|Q8YGI7|CTAA_BRUME Heme A synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ctaA PE=3 SV=2 81 124 7.0E-08
sp|C0RIC2|CTAA_BRUMB Heme A synthase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ctaA PE=3 SV=1 81 124 7.0E-08
sp|A9MAG4|CTAA_BRUC2 Heme A synthase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ctaA PE=3 SV=1 81 124 7.0E-08
sp|Q57DW5|CTAA_BRUAB Heme A synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=ctaA PE=3 SV=1 81 124 7.0E-08
sp|Q2YNB0|CTAA_BRUA2 Heme A synthase OS=Brucella abortus (strain 2308) GN=ctaA PE=3 SV=1 81 124 7.0E-08
sp|B2S532|CTAA_BRUA1 Heme A synthase OS=Brucella abortus (strain S19) GN=ctaA PE=3 SV=1 81 124 7.0E-08
sp|B0CLB4|CTAA_BRUSI Heme A synthase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ctaA PE=3 SV=1 81 124 8.0E-08
sp|A5EKD5|CTAA_BRASB Heme A synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ctaA PE=3 SV=1 74 125 9.0E-08
sp|Q5GSI0|CTAA_WOLTR Heme A synthase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=ctaA PE=3 SV=1 74 124 9.0E-08
sp|A4YVQ0|CTAA_BRASO Heme A synthase OS=Bradyrhizobium sp. (strain ORS278) GN=ctaA PE=3 SV=1 70 125 1.0E-07
sp|A1USH8|CTAA_BARBK Heme A synthase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ctaA PE=3 SV=1 79 124 1.0E-07
sp|A5FA69|CTAA_FLAJ1 Heme A synthase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=ctaA PE=3 SV=1 79 124 1.0E-07
sp|Q9ZDR8|CTAA_RICPR Heme A synthase OS=Rickettsia prowazekii (strain Madrid E) GN=ctaA PE=3 SV=1 84 123 1.0E-07
sp|A6H039|CTAA_FLAPJ Heme A synthase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=ctaA PE=3 SV=1 79 124 1.0E-07
sp|Q136Q9|CTAA_RHOPS Heme A synthase OS=Rhodopseudomonas palustris (strain BisB5) GN=ctaA PE=3 SV=1 84 124 1.0E-07
sp|Q214F0|CTAA_RHOPB Heme A synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=ctaA PE=3 SV=1 81 125 2.0E-07
sp|B3CRU7|CTAA_ORITI Heme A synthase OS=Orientia tsutsugamushi (strain Ikeda) GN=ctaA PE=3 SV=1 84 124 2.0E-07
sp|Q7CZN9|CTAA_AGRFC Heme A synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ctaA PE=3 SV=2 75 124 2.0E-07
sp|Q3YRB4|CTAA_EHRCJ Heme A synthase OS=Ehrlichia canis (strain Jake) GN=ctaA PE=3 SV=1 75 124 2.0E-07
sp|A5CF77|CTAA_ORITB Heme A synthase OS=Orientia tsutsugamushi (strain Boryong) GN=ctaA PE=3 SV=1 84 124 2.0E-07
sp|A6X1W1|CTAA_OCHA4 Heme A synthase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ctaA PE=3 SV=1 81 124 2.0E-07
sp|B5ZXY9|CTAA_RHILW Heme A synthase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ctaA PE=3 SV=1 79 124 3.0E-07
sp|Q07MP8|CTAA_RHOP5 Heme A synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=ctaA PE=3 SV=1 79 124 3.0E-07
sp|A9IVC8|CTAA_BART1 Heme A synthase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=ctaA PE=3 SV=1 79 124 4.0E-07
sp|Q6G011|CTAA_BARQU Heme A synthase OS=Bartonella quintana (strain Toulouse) GN=ctaA PE=3 SV=1 79 124 4.0E-07
sp|Q6G3L5|CTAA_BARHE Heme A synthase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ctaA PE=3 SV=1 79 124 5.0E-07
sp|A8LK55|CTAA_DINSH Heme A synthase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=ctaA PE=3 SV=1 81 125 5.0E-07
sp|Q1MIP9|CTAA_RHIL3 Heme A synthase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ctaA PE=3 SV=1 79 124 7.0E-07
sp|Q2W552|CTAA_MAGSA Heme A synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=ctaA PE=3 SV=1 79 124 7.0E-07
sp|Q2N6M9|CTAA_ERYLH Heme A synthase OS=Erythrobacter litoralis (strain HTCC2594) GN=ctaA PE=3 SV=1 81 124 8.0E-07
sp|A1B8C2|CTAA_PARDP Heme A synthase OS=Paracoccus denitrificans (strain Pd 1222) GN=ctaA PE=3 SV=2 84 124 1.0E-06
sp|Q28PL3|CTAA_JANSC Heme A synthase OS=Jannaschia sp. (strain CCS1) GN=ctaA PE=3 SV=1 96 124 1.0E-06
sp|Q2K9W9|CTAA_RHIEC Heme A synthase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ctaA PE=3 SV=1 79 124 2.0E-06
sp|B9JVB6|CTAA_AGRVS Heme A synthase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=ctaA PE=3 SV=1 84 124 2.0E-06
sp|B3PVH0|CTAA_RHIE6 Heme A synthase OS=Rhizobium etli (strain CIAT 652) GN=ctaA PE=3 SV=1 79 124 2.0E-06
sp|Q08DG6|COX15_BOVIN Cytochrome c oxidase assembly protein COX15 homolog OS=Bos taurus GN=COX15 PE=2 SV=1 8 123 4.0E-06
sp|Q4FLV1|CTAA_PELUB Heme A synthase OS=Pelagibacter ubique (strain HTCC1062) GN=ctaA PE=3 SV=1 75 124 5.0E-06
sp|A9HEV3|CTAA_GLUDA Heme A synthase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=ctaA PE=3 SV=1 81 124 5.0E-06
sp|B1M282|CTAA_METRJ Heme A synthase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=ctaA PE=3 SV=1 99 124 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0006784 heme a biosynthetic process Yes
GO:0055114 oxidation-reduction process Yes
GO:0019438 aromatic compound biosynthetic process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0051186 cofactor metabolic process No
GO:0042440 pigment metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0046160 heme a metabolic process No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0046148 pigment biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0044425 membrane part No
GO:0006779 porphyrin-containing compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016491 oxidoreductase activity No
GO:0006778 porphyrin-containing compound metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0044237 cellular metabolic process No
GO:0006783 heme biosynthetic process No
GO:0051188 cofactor biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0033013 tetrapyrrole metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0042168 heme metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0033014 tetrapyrrole biosynthetic process No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 80 102 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1542
MAFFTPALRRLAFQGPSRFFVCNQCLRQQSPRRPPSTILHLVRSHGYAGAKATATTPPPLNSLASRAATTRVFPE
TTPKGVAYWLMGSAASVFGIVVFGGLTRLTESGLSITEWRPVTGSLPPIC*
Coding >Hirsu2|1542
ATGGCCTTCTTCACGCCGGCACTGCGCCGGCTGGCCTTTCAGGGGCCCTCCCGGTTCTTCGTCTGCAACCAATGC
CTCCGACAACAGTCTCCGCGACGGCCGCCGTCCACGATCCTGCATCTCGTCCGGTCGCACGGCTACGCGGGCGCA
AAGGCGACGGCGACGACGCCGCCGCCGCTGAACAGCTTGGCGAGCCGCGCCGCCACGACGCGCGTCTTCCCCGAG
ACGACGCCAAAGGGGGTGGCGTACTGGCTCATGGGGAGTGCGGCGAGCGTGTTCGGCATCGTCGTGTTTGGCGGC
TTGACGAGGCTCACCGAGTCCGGGCTGAGCATCACGGAATGGAGACCCGTCACGGGGTCGCTGCCGCCCATCTGC
TGA
Transcript >Hirsu2|1542
ATGGCCTTCTTCACGCCGGCACTGCGCCGGCTGGCCTTTCAGGGGCCCTCCCGGTTCTTCGTCTGCAACCAATGC
CTCCGACAACAGTCTCCGCGACGGCCGCCGTCCACGATCCTGCATCTCGTCCGGTCGCACGGCTACGCGGGCGCA
AAGGCGACGGCGACGACGCCGCCGCCGCTGAACAGCTTGGCGAGCCGCGCCGCCACGACGCGCGTCTTCCCCGAG
ACGACGCCAAAGGGGGTGGCGTACTGGCTCATGGGGAGTGCGGCGAGCGTGTTCGGCATCGTCGTGTTTGGCGGC
TTGACGAGGCTCACCGAGTCCGGGCTGAGCATCACGGAATGGAGACCCGTCACGGGGTCGCTGCCGCCCATCTGC
TGA
Gene >Hirsu2|1542
ATGGCCTTCTTCACGCCGGCACTGCGCCGGCTGGCCTTTCAGGGGCCCTCCCGGTTCTTCGTCTGCAACCAATGC
CTCCGACAACAGTCTCCGCGACGGCCGCCGTCCACGATCCTGCATCTCGTCCGGTCGCACGGCTACGCGGGCGCA
AAGGCGACGGCGACGACGCCGCCGCCGCTGAACAGCTTGGCGAGCCGCGCCGCCACGACGCGCGTCTTCCCCGAG
ACGACGCCAAAGGGGGTGGCGTACTGGCTCATGGGGAGTGCGGCGAGCGTGTTCGGCATCGTCGTGTTTGGCGGC
TTGACGAGGCTCACCGAGTCCGGGTACGCGCGTTCCCTCTTCCCCCGTTGCGGGCCGGACGGGAGTGACGGGGCT
AACTCGGGTGGCGGCGCGCAAGGCTGAGCATCACGGAATGGAGACCCGTCACGGGGTCGCTGCCGCCCATGTCGG
CGGCTGACTGGCAGTCCGAGTTCGACAAGTACCGCGCGTCGCCCGAGTTCAAGCTGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail