Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1531
Gene name
LocationContig_134:24110..31453
Strand+
Gene length (bp)7343
Transcript length (bp)7290
Coding sequence length (bp)7290
Protein length (aa) 2430

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14765 PS-DH Polyketide synthase dehydratase 3.9E-63 938 1239
PF08659 KR KR domain 1.7E-53 2017 2195
PF00698 Acyl_transf_1 Acyl transferase domain 1.0E-53 547 867
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 1.3E-52 3 230
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 8.5E-30 239 358
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 8.4E-10 361 408
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 1.4E-10 1817 1930
PF00550 PP-binding Phosphopantetheine attachment site 2.2E-09 2355 2413
PF00106 adh_short short chain dehydrogenase 7.0E-07 2019 2177
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 2.1E-07 1871 1992

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 1265 2.0E-171
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1 1163 6.0E-169
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 1268 2.0E-167
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1 1263 9.0E-153
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1 1263 1.0E-150
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 1265 2.0E-171
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1 1163 6.0E-169
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 1268 2.0E-167
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1 1263 9.0E-153
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1 1263 1.0E-150
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1 838 4.0E-102
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 25 1185 1.0E-100
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 42 866 3.0E-98
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 2 1243 7.0E-98
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 2 1243 7.0E-98
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 2 1243 7.0E-98
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 2 1243 7.0E-98
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 42 866 1.0E-97
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 2 1243 2.0E-97
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1293 2413 7.0E-97
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 42 866 1.0E-96
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1 1113 8.0E-96
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1 915 9.0E-95
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 41 1099 2.0E-94
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 51 972 1.0E-92
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 25 915 5.0E-92
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 36 845 5.0E-92
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 41 984 2.0E-91
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 3 1158 4.0E-91
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 3 1158 4.0E-91
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1 1113 4.0E-91
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 51 875 4.0E-91
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 46 856 9.0E-91
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 46 856 1.0E-89
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 51 983 2.0E-89
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 51 983 3.0E-89
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1 1238 3.0E-88
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 41 945 1.0E-87
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 41 984 1.0E-87
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 3 915 3.0E-87
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 38 984 9.0E-86
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 44 984 1.0E-85
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 19 849 2.0E-85
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 19 849 2.0E-85
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 19 849 2.0E-85
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 44 889 2.0E-84
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 43 984 3.0E-84
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 28 847 9.0E-84
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 39 984 1.0E-81
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 39 1063 2.0E-81
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 39 984 6.0E-81
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 39 984 7.0E-81
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 40 984 9.0E-81
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 51 894 4.0E-80
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 40 984 5.0E-80
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 40 1002 3.0E-79
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 39 1007 8.0E-79
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 39 984 1.0E-78
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 40 1078 8.0E-78
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 29 984 2.0E-77
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 31 891 5.0E-76
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 39 984 1.0E-74
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 44 1061 2.0E-74
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 51 862 2.0E-74
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 40 984 1.0E-73
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 44 882 3.0E-73
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 40 984 2.0E-72
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 40 1002 2.0E-71
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 4 869 7.0E-71
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 39 984 1.0E-67
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 51 889 2.0E-67
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 51 888 2.0E-67
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 51 888 2.0E-67
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 51 888 2.0E-67
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 3 407 6.0E-67
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 3 407 6.0E-67
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 3 407 9.0E-67
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 1 405 2.0E-65
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 4 515 1.0E-64
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1627 2198 3.0E-63
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1627 2198 3.0E-63
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 10 426 4.0E-63
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 5 515 7.0E-63
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1 406 3.0E-60
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 41 398 3.0E-60
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 46 405 4.0E-59
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 41 406 8.0E-59
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 51 405 2.0E-58
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 19 406 3.0E-58
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 5 414 6.0E-58
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 41 535 2.0E-57
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 46 406 2.0E-57
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 5 406 3.0E-57
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 46 350 1.0E-55
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1568 2228 2.0E-52
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 40 405 6.0E-52
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1570 2200 5.0E-49
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1562 2198 5.0E-49
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1570 2200 6.0E-49
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1570 2200 6.0E-49
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1570 2200 6.0E-49
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1570 2200 6.0E-49
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 40 410 1.0E-48
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1680 2193 5.0E-48
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 39 405 5.0E-48
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1680 2203 6.0E-48
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 40 405 6.0E-48
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 40 405 9.0E-48
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 40 405 2.0E-47
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 41 405 3.0E-47
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 33 409 1.0E-46
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 5 521 7.0E-45
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 40 405 7.0E-45
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 51 407 2.0E-44
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 30 409 2.0E-44
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1711 2208 1.0E-43
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1740 2202 9.0E-43
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1711 2198 2.0E-42
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 29 414 3.0E-42
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 31 406 8.0E-42
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1711 2198 9.0E-42
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 51 419 1.0E-41
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1675 2417 4.0E-41
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1675 2417 3.0E-39
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1675 2417 7.0E-39
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1704 2200 1.0E-38
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1695 2211 1.0E-38
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1702 2403 4.0E-37
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1695 2203 2.0E-36
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1212 2203 4.0E-36
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1560 2231 1.0E-35
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1690 2230 1.0E-35
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1697 2232 1.0E-35
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1311 2253 2.0E-35
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1702 2224 1.0E-34
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1683 2192 1.0E-34
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1529 2210 2.0E-34
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1683 2403 3.0E-34
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1702 2192 5.0E-34
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1696 2190 8.0E-34
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1697 2342 1.0E-33
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 547 856 1.0E-33
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 541 886 1.0E-33
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1696 2190 2.0E-33
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 533 856 3.0E-33
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1697 2228 4.0E-33
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1690 2203 2.0E-32
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1697 2203 7.0E-31
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1697 2232 9.0E-31
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1683 2232 3.0E-30
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1697 2232 4.0E-30
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1575 2226 2.0E-29
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1697 2228 7.0E-29
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1697 2236 1.0E-28
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1697 2236 1.0E-28
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1702 2236 3.0E-28
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1683 2403 4.0E-28
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1702 2229 4.0E-28
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1697 2232 4.0E-28
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1697 2203 5.0E-28
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1575 2203 8.0E-28
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1697 2235 9.0E-28
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 471 984 6.0E-27
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 548 984 1.0E-26
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 548 984 2.0E-26
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 498 1228 1.0E-25
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 498 1228 1.0E-25
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 498 1228 1.0E-25
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 548 985 1.0E-25
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 545 984 1.0E-25
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1985 2422 4.0E-25
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 548 1113 4.0E-25
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 2007 2410 7.0E-25
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 548 984 9.0E-25
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 547 895 2.0E-22
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 78 400 2.0E-22
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 78 400 3.0E-22
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 74 409 8.0E-22
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 547 848 1.0E-21
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 129 408 4.0E-21
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 129 408 4.0E-21
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 129 408 4.0E-21
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 129 408 4.0E-21
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1366 2230 8.0E-21
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1366 2203 9.0E-21
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 51 405 7.0E-20
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 2031 2192 9.0E-20
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 111 405 2.0E-19
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 47 408 2.0E-19
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 103 405 5.0E-19
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 2012 2193 6.0E-19
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 51 398 1.0E-18
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 65 368 2.0E-18
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 103 405 2.0E-18
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 79 400 3.0E-18
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 57 398 6.0E-18
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 545 882 7.0E-18
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 51 408 7.0E-18
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 79 400 1.0E-17
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 62 405 1.0E-17
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 128 398 2.0E-17
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 1695 1993 3.0E-17
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 58 400 5.0E-17
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 92 400 8.0E-17
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 127 400 9.0E-17
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 127 400 9.0E-17
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 58 400 1.0E-16
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 58 400 1.0E-16
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 58 400 1.0E-16
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 58 400 1.0E-16
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 126 400 1.0E-16
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 2014 2228 2.0E-16
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 2014 2228 2.0E-16
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 2014 2228 2.0E-16
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 41 400 3.0E-16
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 41 400 3.0E-16
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 41 400 3.0E-16
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 1676 1907 3.0E-16
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 51 398 4.0E-16
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 129 410 7.0E-16
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2034 2413 1.0E-15
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 2012 2198 1.0E-15
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 2012 2198 2.0E-15
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 51 398 3.0E-15
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 1667 1925 4.0E-15
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 129 400 5.0E-15
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 1695 1995 6.0E-15
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 1676 1907 7.0E-15
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 1701 1925 1.0E-14
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 51 400 1.0E-14
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 128 398 2.0E-14
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 107 405 4.0E-14
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 1691 1999 4.0E-14
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 544 855 5.0E-14
sp|P0C842|CJ052_HUMAN Putative uncharacterized protein encoded by LINC00614 OS=Homo sapiens GN=LINC00614 PE=5 SV=1 7 106 7.0E-14
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 1676 1907 8.0E-14
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 2009 2188 9.0E-14
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 1676 1907 1.0E-13
sp|P43678|KAS1_STRRM Oxytetracycline polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces rimosus PE=3 SV=2 51 368 2.0E-13
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 545 848 2.0E-13
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 2014 2183 3.0E-13
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2018 2179 3.0E-13
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 1674 1907 4.0E-13
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 41 400 5.0E-13
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 1676 1907 6.0E-13
sp|P39525|CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEM1 PE=1 SV=1 74 400 8.0E-13
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 1676 1907 8.0E-13
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 1695 1995 1.0E-12
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 79 405 1.0E-12
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 1676 1992 2.0E-12
sp|P9WQD9|FAB1_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasA PE=1 SV=1 127 400 2.0E-12
sp|P9WQD8|FAB1_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasA PE=3 SV=1 127 400 2.0E-12
sp|H8ESN0|FAB1_MYCTE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=kasA PE=2 SV=2 127 400 2.0E-12
sp|P63455|FAB1_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasA PE=3 SV=1 127 400 2.0E-12
sp|Q24K16|ZADH2_BOVIN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 1691 1933 2.0E-12
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 119 405 3.0E-12
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 1676 1907 3.0E-12
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 1676 1907 4.0E-12
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 1695 1995 5.0E-12
sp|Q8N4Q0|ZADH2_HUMAN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Homo sapiens GN=ZADH2 PE=1 SV=1 1691 1992 6.0E-12
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2015 2192 1.0E-11
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 547 848 1.0E-11
sp|Q9CBS7|FAB1_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium leprae (strain TN) GN=kasA PE=3 SV=1 150 400 1.0E-11
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 1702 1995 2.0E-11
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 67 405 4.0E-11
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 63 405 5.0E-11
sp|Q8KA28|FABB_BUCAP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabB PE=3 SV=1 119 405 6.0E-11
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 2033 2198 1.0E-10
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 2033 2198 1.0E-10
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 2033 2198 1.0E-10
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2018 2181 1.0E-10
sp|P0A953|FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) GN=fabB PE=1 SV=1 121 405 1.0E-10
sp|P0A954|FABB_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabB PE=3 SV=1 121 405 1.0E-10
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 1701 1992 1.0E-10
sp|Q8NVD1|ZDH1_STAAW Zinc-type alcohol dehydrogenase-like protein MW2112 OS=Staphylococcus aureus (strain MW2) GN=MW2112 PE=3 SV=1 1687 1993 1.0E-10
sp|Q6G7C8|ZDH1_STAAS Zinc-type alcohol dehydrogenase-like protein SAS2087 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2087 PE=3 SV=1 1687 1993 1.0E-10
sp|Q02K94|FABB_PSEAB 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fabB PE=1 SV=1 79 405 1.0E-10
sp|Q6GEP3|ZDH1_STAAR Zinc-type alcohol dehydrogenase-like protein SAR2277 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2277 PE=3 SV=1 1687 1993 2.0E-10
sp|P99173|ZDH1_STAAN Zinc-type alcohol dehydrogenase-like protein SA1988 OS=Staphylococcus aureus (strain N315) GN=SA1988 PE=1 SV=1 1687 1993 2.0E-10
sp|P63475|ZDH1_STAAM Zinc-type alcohol dehydrogenase-like protein SAV2186 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2186 PE=3 SV=1 1687 1993 2.0E-10
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 2033 2193 3.0E-10
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 2033 2193 3.0E-10
sp|P40804|PKSF_BACSU Polyketide biosynthesis malonyl-ACP decarboxylase PksF OS=Bacillus subtilis (strain 168) GN=pksF PE=1 SV=3 69 411 3.0E-10
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 543 840 3.0E-10
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 2000 2192 4.0E-10
sp|P38230|QOR_YEAST Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 1731 1907 6.0E-10
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 1731 1930 8.0E-10
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 1697 1993 8.0E-10
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 1697 1962 1.0E-09
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 1747 1992 1.0E-09
sp|Q975C8|ACAR_SULTO Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 1695 1992 1.0E-09
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 1747 1992 2.0E-09
sp|Q5HE19|ZDH1_STAAC Zinc-type alcohol dehydrogenase-like protein SACOL2177 OS=Staphylococcus aureus (strain COL) GN=SACOL2177 PE=3 SV=1 1687 1993 3.0E-09
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 545 848 4.0E-09
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 545 852 6.0E-09
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1301 1643 8.0E-09
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 1999 2186 1.0E-08
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 545 856 1.0E-08
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1301 1645 3.0E-08
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 1698 1907 4.0E-08
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 1698 1907 4.0E-08
sp|O74489|QOR_SCHPO Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 1691 1908 6.0E-08
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 2018 2179 7.0E-08
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1301 1643 2.0E-07
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 545 847 2.0E-07
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1995 2177 1.0E-06
sp|A4YGN2|ACAR_METS5 Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 1691 1919 1.0E-06
sp|P34055|INC11_HYPAT Protein indc11 OS=Hypocrea atroviridis GN=indc11 PE=2 SV=1 1672 1899 3.0E-06
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2010 2181 4.0E-06
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 544 847 4.0E-06
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 544 847 4.0E-06
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 544 847 4.0E-06
sp|P16539|KAS2_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 2 OS=Streptomyces glaucescens GN=tcmL PE=3 SV=2 116 405 4.0E-06
sp|Q93QD4|FABD_STAAU Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1 544 847 5.0E-06
sp|Q5HGK3|FABD_STAAC Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1 544 847 5.0E-06
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 544 847 5.0E-06
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2044 2177 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1531
LRELLREQRDVQVEFAEPRFSARGFHHPDADRPGTAVAGSGFLLDEDPRLFDTSFFGITDLEAETMDASQRKLLE
VTYEAFENAGETWESVSGARVGVFVGDISLDGYLAQAKDWENSSRYSATGAFPNMLANRLHYVFNLKGPSLVVNS
ACTSAMYALHLAVASMRNGDCDSAVVAGSNWIVDPSCHMAMGKLGALSPTSRSHTFDASADGYARGEGFVALYLK
TSSQAIRDAAPIRALIVGTAVNANGRTNGIVSPSGPAQESVIREAYKNAGGLDPSETMFLECHGTGTQVGDPVEV
TAAGNVFGIARSDAYQDRLLMGSIKTNLGHLEGACALPGILKVVAALEAGEIPPTLGFKTPNPRIDFDKAKARVV
ADVEPWPENRLKRASVTSAGFGGTNGHCIIDHVLKVVPRYLKPGILAQHPGASLGGHGASEHGANGSNGHRPQHR
PITNTPTMARKAEVTTRQLVLLPFSAHNKASLAANIEALFRVLDQHSLPDVAYTLAAKRSRFSQRAFHIVDKDDL
GQTARGNGPQIFSSPQQVRIGFVFTGQGAQWQAMGAELFEYAIFRDAMSYLDHVLAMLPEPASWKIVDVLSGNCD
GDLIQTPAVSQTVCTALQIGLVDLLASWSILPAGVVGHSSGEIAAAYAAGHITAAEAIVIASYRGVSVSSSTKKG
AMLAVGLSHSQGDERIKNAGLEDQVKVAAINSGDSITMSGDADAIGELCAELNREDIFNRRLRTGGLAYHSHHML
PLSRDYAQAVEAGLEALGPSSDAERYPSVPWISTVMPEKSTTTSRERVTASYWKANMQSPVRFSEAVAKLLCLDD
LGIGAVVEIGPHPALKSALEQIVKKLGKTVPHVASLKRGVDARRSLLDLAGTLYALNAPVNLTAVNAVDDGMRGL
AHGTTAVNLPPYQYRYGPIKYHESRLSREYRLRRVPRHDLLGSKVAGTARLRPQWRNILRLKDLPWLHHHRMPPH
VLHPGAAHIVMAMVAAEQAYAELPDALSVVGFSLRNVSIKRTLVVPEDDNGIEIVLSLELEDEATAGSPRWAGFS
IASVARDSDQWTEHCSGLVKVEVSDFQQAAPIDKAMDGRAVDAQRWHKRFVEMGMLFGPSFQGHADIRADPNKNI
ASAKLALKTTAGMFPGGESSYPIHPASLDLAIRLGLMACHGGQTETGRVQLPIHLNQLRLRHRCLQGRDWVTGIS
RGELCGLRGACAQLQILDDAGDVALDVDMMRFTSLDNEDSSFRSSGPSSKAYASPFARLVWRPDVRTLSASQRRA
LFSPSGGSSGGGIGAFPQLSHIFDLLGHAEPDLRVLELGGGGDTGAAQVALKTLVGANGIKRYRKFAVTDVSQER
LASARQSTSEFGDISYSVLDINDDPLQQGFRPASYDVVLWPKAPVATHDALENCRKLIRPRGSIILVEPAEDHAG
VSRDDALQKAGFARGLELTVDEPDRHSTVVFSALHDEARQHGRQIPVVSLLHGAKGPPALVTHLARAMEERGLCP
KIMPLDRAHDTVPPNSRVVAFLDCENLLLDADQRRLGLFQHLAANAASMVWITSCGMVKGRNPDGALVAGLLRTL
GTENPAGQFLSVDVDAEDFDVDEDDVGELVRCLIDQELALQGAGGDSAVNRELAWQDGCMWISRIVPDAELQGYA
EVTDAPDDHDMQMVTLESQGPVCAAFGTPGILTSLYFRAYRELWKPLARDHIEVKVDAVGLNWKDLGVCSGRLDQ
NNFSNEYCGTVAKKGFDVTGFEVGDRVYGMGKGHFGNYTRVPAALGQKLRPDADTIEVATMPVAYMTAVYAFEHV
TRLRRGQKVLIQSASGGLGLAAIQLARSKGADIFVTAGTSEKARFLTESMGISPTKVFSSRDPADLLRMVGATKN
GGFDVVLSTAQGDMLHESIKALAPLGHLVDVGRLDVTSSKNVALDLFQKSATFTSFDLGLVVDRDAGLGQELMRA
VDEHWRAGRIGPIRPHTVSDLSQLDQVLLQFSKGKHIGKMVISYQNPSSIVKMHQSVSPAHFDPEARYILVGGLS
GLGRTIVRWMCDRGARDLVVWSRSGADRLDPEAVALIDELAAQGVRIQPVTCDVSQREQVVRAVQDANADRIVRG
VLHFAVSYQDISFDKMTEDKFHQGIAAKVLGTRNLDEATASLPLDFFVMTSSLGTVYAFPTQSAYLAANNFLDYF
ARYRRRRGLPASTVSLGFINDLGPLAQDPMTVNLFVRTRGQTVTGSQVLRLLEPAFMSQHKGRREWLGRSQDPLS
EANIITGMDPAAFVTMRRDEAMGGPVPRWYHDARASLMLRAQDDAWRHHNEASGVKGAQELDAAADESPTAQLRR
RFEASINRLRTTDGGDDKEQRAEAVGLVTDAVQAAVARLLFVDPSAVDAANTVVELGIDSLLAAEFRSWLRAAFG
KNISMLDLMDARTKIHVLARTVVDEAVRP*
Coding >Hirsu2|1531
CTGAGGGAGTTGCTCAGGGAGCAGAGAGACGTGCAGGTTGAGTTCGCGGAGCCGCGCTTCTCGGCCCGGGGCTTC
CATCACCCAGATGCGGACCGTCCCGGAACGGCCGTGGCCGGCAGCGGTTTTCTGCTCGACGAGGATCCGCGGCTG
TTTGACACCTCCTTCTTCGGTATTACCGACCTAGAGGCCGAGACCATGGACGCGTCGCAGCGCAAGCTCCTCGAG
GTGACGTACGAGGCCTTCGAGAACGCGGGCGAGACGTGGGAAAGCGTCTCGGGCGCCCGAGTCGGCGTCTTCGTC
GGCGACATCTCCTTGGACGGATACCTTGCCCAGGCCAAGGATTGGGAGAACAGCTCCAGGTACTCGGCCACGGGG
GCGTTCCCCAACATGCTGGCCAACCGCCTCCACTACGTCTTCAACCTCAAAGGGCCGAGCCTCGTCGTCAACAGC
GCGTGCACGTCGGCCATGTACGCCCTCCATCTTGCCGTCGCCTCGATGCGCAACGGCGACTGCGACTCAGCCGTG
GTTGCGGGCTCCAACTGGATCGTCGACCCGAGCTGTCACATGGCTATGGGCAAGCTGGGCGCCCTGTCGCCCACC
TCGAGGAGCCACACCTTTGACGCGTCTGCCGACGGCTACGCCCGTGGCGAGGGCTTCGTCGCGCTCTACCTGAAG
ACGTCCTCGCAGGCGATTCGGGACGCCGCTCCGATCCGCGCCCTGATCGTGGGGACCGCCGTCAATGCCAACGGC
CGGACGAACGGTATCGTTAGCCCGAGCGGCCCTGCGCAGGAGAGTGTCATTCGCGAGGCCTACAAGAACGCGGGC
GGCCTTGATCCTTCGGAAACGATGTTCCTCGAGTGCCACGGCACAGGCACGCAAGTTGGAGATCCTGTCGAGGTG
ACAGCGGCCGGCAACGTCTTCGGAATTGCGAGGTCGGATGCGTATCAGGACCGCCTGCTGATGGGGTCTATCAAA
ACTAACCTGGGCCATTTAGAGGGCGCCTGCGCGCTTCCAGGAATTCTTAAGGTCGTGGCCGCCCTCGAGGCCGGC
GAGATACCGCCCACCCTCGGCTTTAAGACGCCAAACCCACGTATCGACTTCGACAAGGCCAAGGCCAGGGTAGTA
GCGGATGTCGAGCCCTGGCCGGAAAATAGACTGAAGCGGGCAAGTGTCACGTCTGCGGGCTTTGGCGGAACAAAC
GGCCACTGCATAATCGATCATGTTCTTAAGGTGGTGCCGCGCTACCTTAAGCCGGGCATCCTCGCTCAGCATCCC
GGGGCATCACTTGGCGGCCACGGGGCAAGCGAACACGGGGCCAACGGCTCGAATGGCCACCGGCCGCAACATCGC
CCGATAACTAACACGCCGACCATGGCCAGGAAAGCCGAGGTCACCACCCGTCAACTCGTGCTTCTCCCGTTCTCG
GCGCATAACAAGGCCTCGCTTGCCGCAAATATAGAGGCGTTATTCCGCGTTCTCGACCAGCACTCGCTGCCCGAC
GTGGCCTATACTCTGGCCGCCAAGCGCTCGCGCTTCTCCCAGCGAGCCTTTCACATAGTAGACAAGGACGATCTC
GGGCAGACCGCTCGGGGGAATGGGCCCCAGATCTTCTCCTCACCCCAGCAGGTGCGCATAGGCTTCGTCTTCACG
GGCCAAGGTGCCCAGTGGCAGGCCATGGGGGCCGAGCTCTTCGAGTACGCCATATTCCGAGACGCCATGTCCTAC
CTAGACCACGTGCTTGCCATGCTGCCCGAGCCCGCCTCGTGGAAGATTGTCGACGTCTTGTCCGGAAATTGCGAT
GGGGACTTGATACAGACACCTGCCGTCTCGCAGACTGTTTGCACGGCGCTGCAGATCGGACTCGTCGATCTCCTC
GCTTCGTGGTCGATTCTGCCTGCCGGCGTGGTGGGACATTCGTCGGGCGAAATCGCGGCGGCATATGCGGCGGGC
CACATCACCGCCGCGGAGGCGATCGTAATCGCCTCTTACCGTGGCGTCAGCGTCTCTTCGAGCACGAAGAAGGGT
GCAATGTTGGCCGTGGGTTTGAGCCACAGCCAGGGCGATGAGCGTATCAAGAATGCGGGCTTGGAGGACCAGGTC
AAGGTTGCTGCCATCAACTCCGGGGACAGCATCACCATGTCCGGCGATGCCGACGCTATCGGTGAGCTGTGTGCG
GAGCTGAACAGGGAGGACATATTCAACAGGCGGCTCCGGACAGGCGGACTTGCGTACCATTCTCACCATATGCTC
CCATTGAGCCGCGACTACGCCCAGGCAGTAGAAGCTGGACTTGAGGCGTTGGGCCCCTCCAGCGACGCTGAAAGA
TACCCCAGTGTCCCGTGGATTTCGACCGTCATGCCAGAAAAGAGCACGACAACCTCCCGGGAACGTGTGACGGCG
TCGTACTGGAAAGCCAATATGCAGTCCCCGGTGCGCTTCAGTGAGGCTGTGGCCAAGCTTCTCTGCCTCGACGAC
CTGGGGATCGGCGCCGTGGTGGAGATCGGTCCTCACCCGGCGCTCAAGAGCGCCTTGGAGCAGATCGTCAAGAAG
CTTGGCAAGACCGTTCCGCATGTCGCGTCGCTGAAGAGGGGCGTAGACGCCCGCAGATCGCTGCTGGACCTCGCT
GGCACTCTGTACGCCCTCAACGCCCCCGTCAACTTGACGGCAGTCAACGCCGTCGACGACGGGATGCGAGGGCTG
GCGCATGGCACCACGGCCGTCAACTTGCCGCCATATCAGTACAGATACGGTCCCATAAAGTACCACGAGAGCCGG
CTGAGTAGGGAATACCGCCTCCGTCGGGTTCCTCGCCATGATCTCCTGGGATCCAAGGTGGCCGGCACCGCCAGG
CTGCGTCCGCAGTGGCGAAACATTCTGCGCCTCAAGGACCTGCCCTGGCTGCACCACCACCGCATGCCGCCGCAC
GTCCTGCACCCCGGTGCCGCGCACATCGTCATGGCAATGGTGGCGGCCGAGCAGGCCTATGCCGAGCTCCCAGAC
GCGCTTTCCGTTGTGGGCTTCAGCCTCCGCAACGTTTCCATCAAGAGGACGCTGGTGGTTCCAGAGGACGACAAC
GGCATCGAGATCGTGCTCAGCCTGGAGCTTGAGGACGAAGCAACTGCTGGTTCACCGCGCTGGGCTGGTTTCTCC
ATCGCTTCCGTTGCCCGTGACTCGGACCAGTGGACCGAGCACTGCTCCGGCCTCGTCAAGGTCGAAGTCTCTGAC
TTTCAACAGGCGGCGCCAATCGACAAAGCAATGGACGGACGAGCCGTCGATGCGCAAAGGTGGCATAAGCGCTTT
GTGGAAATGGGCATGCTATTTGGCCCTTCTTTCCAAGGCCACGCGGATATTCGCGCCGATCCGAACAAGAATATC
GCTTCGGCCAAGCTGGCCCTCAAGACGACGGCGGGCATGTTCCCTGGCGGCGAGTCTAGCTACCCCATTCACCCG
GCTTCCCTCGATCTCGCCATCCGCCTTGGACTCATGGCCTGCCACGGCGGCCAGACAGAGACGGGCAGGGTCCAG
CTCCCCATCCACTTGAACCAGCTGCGGCTCAGGCACCGTTGCCTGCAGGGTCGCGACTGGGTCACCGGCATCTCA
CGCGGCGAGCTTTGCGGATTGCGCGGTGCGTGTGCCCAGCTGCAGATACTGGACGACGCAGGTGATGTCGCCCTG
GACGTTGACATGATGCGCTTCACCAGCCTCGACAACGAGGACTCATCCTTCCGCAGCAGTGGCCCGTCGAGCAAG
GCGTATGCCAGTCCCTTTGCGCGCCTTGTCTGGAGGCCCGACGTCCGCACACTGAGCGCGAGCCAGCGCCGAGCC
TTGTTCTCGCCCTCGGGGGGGAGCTCCGGGGGGGGCATCGGCGCTTTTCCACAGCTGTCTCACATCTTCGACTTG
CTGGGCCACGCCGAGCCCGATCTCCGAGTCCTAGAACTGGGCGGCGGCGGCGATACGGGCGCTGCGCAGGTCGCC
CTGAAGACGCTCGTAGGTGCCAACGGGATCAAGCGGTACCGGAAATTCGCCGTGACCGACGTCTCCCAGGAGCGG
CTTGCATCGGCCCGCCAGTCGACGTCGGAGTTCGGCGACATCAGTTATTCCGTTCTGGACATCAACGACGATCCG
CTGCAGCAGGGCTTCCGGCCAGCCAGCTACGACGTCGTCCTCTGGCCGAAGGCTCCTGTGGCCACTCACGACGCG
CTCGAAAACTGCCGGAAGCTCATCAGGCCGCGCGGGAGCATCATCCTGGTCGAACCCGCCGAGGATCATGCTGGC
GTCTCTCGGGATGACGCCCTACAAAAGGCTGGTTTTGCGCGGGGTCTTGAGCTGACAGTGGACGAGCCGGACCGC
CACTCCACCGTCGTCTTTTCCGCTTTGCATGATGAAGCCAGGCAGCACGGGAGGCAGATCCCAGTGGTGAGTCTC
CTCCACGGTGCCAAGGGCCCCCCGGCGCTGGTGACCCATCTGGCTCGGGCCATGGAAGAACGGGGACTGTGCCCC
AAGATCATGCCGCTTGATCGTGCGCACGATACCGTACCGCCTAATTCCCGTGTGGTGGCGTTCTTGGACTGTGAA
AATCTCTTGCTCGATGCCGACCAGCGCCGTCTTGGGCTTTTCCAGCACCTTGCCGCAAATGCCGCCAGCATGGTT
TGGATCACGTCGTGCGGCATGGTCAAAGGCCGCAATCCCGACGGCGCCCTCGTAGCCGGCCTGCTGCGGACACTG
GGGACAGAGAATCCAGCGGGTCAATTTCTCTCCGTTGACGTAGATGCTGAGGACTTCGACGTCGACGAGGATGAC
GTGGGCGAGCTGGTACGCTGCTTGATCGATCAAGAGCTCGCGCTGCAAGGAGCAGGCGGCGACAGCGCCGTAAAC
CGCGAGCTAGCCTGGCAGGACGGTTGCATGTGGATCAGCCGGATTGTTCCCGACGCCGAGCTCCAGGGCTACGCC
GAGGTGACAGACGCTCCGGATGACCACGACATGCAGATGGTGACCCTCGAAAGCCAGGGCCCCGTGTGCGCGGCC
TTTGGCACACCCGGTATACTGACCTCGCTCTACTTTCGAGCCTACAGGGAGCTCTGGAAACCTTTGGCTCGAGAT
CATATCGAGGTCAAGGTGGACGCCGTTGGCCTCAACTGGAAGGACCTTGGCGTCTGTTCCGGCCGTCTCGATCAG
AACAACTTCTCCAACGAGTACTGCGGCACCGTAGCCAAGAAAGGATTCGACGTGACCGGCTTCGAGGTCGGCGAC
CGGGTCTACGGCATGGGAAAGGGGCACTTCGGAAACTACACGCGAGTGCCGGCAGCACTCGGGCAGAAGCTGCGG
CCCGATGCCGACACGATCGAGGTTGCCACCATGCCTGTGGCATACATGACCGCTGTATATGCTTTCGAACACGTC
ACTCGTCTGAGACGTGGGCAGAAGGTGTTGATCCAGTCCGCCTCGGGCGGCCTCGGGCTCGCGGCCATCCAGCTG
GCGCGCTCAAAGGGCGCTGACATCTTCGTCACAGCCGGCACGTCGGAAAAGGCTCGCTTTTTGACCGAGAGCATG
GGCATTTCGCCCACCAAAGTCTTTTCCTCGCGCGATCCTGCCGACCTGTTGCGCATGGTTGGTGCGACTAAGAAC
GGTGGATTCGACGTCGTCCTCAGCACCGCCCAAGGCGACATGCTGCATGAGTCCATCAAGGCGCTGGCGCCGCTG
GGCCACCTAGTCGACGTCGGCCGGCTCGATGTCACGAGCTCCAAGAACGTTGCGCTGGATCTCTTCCAGAAGAGC
GCCACCTTTACCTCGTTCGATCTCGGCCTCGTAGTGGATCGCGACGCCGGCCTCGGCCAAGAACTTATGCGGGCG
GTGGACGAGCATTGGCGCGCCGGTCGCATAGGGCCCATTCGGCCTCACACGGTGTCGGACCTTTCACAGCTCGAC
CAGGTGCTTCTCCAGTTTTCAAAGGGCAAGCACATCGGGAAGATGGTGATATCGTACCAGAATCCCAGCTCCATC
GTCAAGATGCATCAGTCGGTCTCCCCCGCTCATTTCGACCCGGAAGCTCGCTATATCTTGGTCGGCGGGCTAAGC
GGTCTTGGGCGGACCATCGTCAGGTGGATGTGTGATCGCGGTGCTCGGGACCTGGTCGTCTGGTCCAGGAGCGGT
GCCGACCGTCTCGATCCTGAAGCGGTGGCGCTTATCGACGAGCTCGCGGCTCAGGGTGTGCGGATACAGCCGGTG
ACCTGCGACGTGAGCCAGCGGGAGCAGGTGGTACGGGCCGTACAAGACGCCAACGCCGACAGGATCGTACGTGGA
GTCCTCCACTTTGCCGTATCTTACCAGGACATCTCGTTCGACAAGATGACGGAGGACAAGTTCCACCAAGGCATA
GCAGCCAAGGTGTTGGGGACAAGGAATCTCGATGAGGCGACAGCCTCGTTGCCCCTCGACTTTTTCGTCATGACC
TCATCCCTCGGCACCGTATATGCTTTCCCCACGCAGAGCGCCTACCTGGCAGCAAACAACTTCCTGGACTACTTT
GCGCGTTACCGCCGGCGGCGTGGGCTGCCGGCGTCGACCGTGTCTCTGGGCTTCATCAACGACCTGGGTCCCCTG
GCCCAGGACCCCATGACCGTAAATCTGTTCGTGCGCACCAGGGGCCAGACCGTGACGGGGAGCCAGGTCTTGCGC
CTGCTGGAGCCAGCCTTTATGAGCCAGCACAAGGGTCGCCGTGAATGGCTCGGCCGCTCCCAAGATCCGCTATCG
GAAGCCAACATCATCACCGGCATGGACCCAGCAGCCTTCGTAACGATGAGACGAGACGAGGCCATGGGAGGCCCC
GTGCCCAGGTGGTACCACGATGCGCGCGCCTCTCTGATGCTACGCGCTCAGGACGACGCCTGGCGCCACCACAAC
GAAGCCAGCGGCGTCAAGGGCGCACAGGAGCTGGACGCCGCCGCCGACGAGTCCCCCACAGCACAGCTGCGACGG
CGGTTCGAGGCTTCGATCAATAGGCTCCGCACCACAGACGGTGGAGACGACAAGGAGCAGCGGGCCGAGGCGGTC
GGACTCGTAACGGACGCCGTCCAGGCAGCAGTGGCGAGACTGCTATTCGTGGATCCGTCGGCCGTGGATGCGGCC
AACACGGTGGTGGAACTGGGCATCGACAGTCTGCTAGCGGCCGAGTTCCGAAGCTGGCTGCGCGCCGCCTTCGGC
AAGAACATCAGCATGCTGGACCTGATGGATGCGAGGACCAAGATCCACGTGCTGGCGCGGACCGTCGTGGACGAG
GCGGTCAGGCCGTAG
Transcript >Hirsu2|1531
CTGAGGGAGTTGCTCAGGGAGCAGAGAGACGTGCAGGTTGAGTTCGCGGAGCCGCGCTTCTCGGCCCGGGGCTTC
CATCACCCAGATGCGGACCGTCCCGGAACGGCCGTGGCCGGCAGCGGTTTTCTGCTCGACGAGGATCCGCGGCTG
TTTGACACCTCCTTCTTCGGTATTACCGACCTAGAGGCCGAGACCATGGACGCGTCGCAGCGCAAGCTCCTCGAG
GTGACGTACGAGGCCTTCGAGAACGCGGGCGAGACGTGGGAAAGCGTCTCGGGCGCCCGAGTCGGCGTCTTCGTC
GGCGACATCTCCTTGGACGGATACCTTGCCCAGGCCAAGGATTGGGAGAACAGCTCCAGGTACTCGGCCACGGGG
GCGTTCCCCAACATGCTGGCCAACCGCCTCCACTACGTCTTCAACCTCAAAGGGCCGAGCCTCGTCGTCAACAGC
GCGTGCACGTCGGCCATGTACGCCCTCCATCTTGCCGTCGCCTCGATGCGCAACGGCGACTGCGACTCAGCCGTG
GTTGCGGGCTCCAACTGGATCGTCGACCCGAGCTGTCACATGGCTATGGGCAAGCTGGGCGCCCTGTCGCCCACC
TCGAGGAGCCACACCTTTGACGCGTCTGCCGACGGCTACGCCCGTGGCGAGGGCTTCGTCGCGCTCTACCTGAAG
ACGTCCTCGCAGGCGATTCGGGACGCCGCTCCGATCCGCGCCCTGATCGTGGGGACCGCCGTCAATGCCAACGGC
CGGACGAACGGTATCGTTAGCCCGAGCGGCCCTGCGCAGGAGAGTGTCATTCGCGAGGCCTACAAGAACGCGGGC
GGCCTTGATCCTTCGGAAACGATGTTCCTCGAGTGCCACGGCACAGGCACGCAAGTTGGAGATCCTGTCGAGGTG
ACAGCGGCCGGCAACGTCTTCGGAATTGCGAGGTCGGATGCGTATCAGGACCGCCTGCTGATGGGGTCTATCAAA
ACTAACCTGGGCCATTTAGAGGGCGCCTGCGCGCTTCCAGGAATTCTTAAGGTCGTGGCCGCCCTCGAGGCCGGC
GAGATACCGCCCACCCTCGGCTTTAAGACGCCAAACCCACGTATCGACTTCGACAAGGCCAAGGCCAGGGTAGTA
GCGGATGTCGAGCCCTGGCCGGAAAATAGACTGAAGCGGGCAAGTGTCACGTCTGCGGGCTTTGGCGGAACAAAC
GGCCACTGCATAATCGATCATGTTCTTAAGGTGGTGCCGCGCTACCTTAAGCCGGGCATCCTCGCTCAGCATCCC
GGGGCATCACTTGGCGGCCACGGGGCAAGCGAACACGGGGCCAACGGCTCGAATGGCCACCGGCCGCAACATCGC
CCGATAACTAACACGCCGACCATGGCCAGGAAAGCCGAGGTCACCACCCGTCAACTCGTGCTTCTCCCGTTCTCG
GCGCATAACAAGGCCTCGCTTGCCGCAAATATAGAGGCGTTATTCCGCGTTCTCGACCAGCACTCGCTGCCCGAC
GTGGCCTATACTCTGGCCGCCAAGCGCTCGCGCTTCTCCCAGCGAGCCTTTCACATAGTAGACAAGGACGATCTC
GGGCAGACCGCTCGGGGGAATGGGCCCCAGATCTTCTCCTCACCCCAGCAGGTGCGCATAGGCTTCGTCTTCACG
GGCCAAGGTGCCCAGTGGCAGGCCATGGGGGCCGAGCTCTTCGAGTACGCCATATTCCGAGACGCCATGTCCTAC
CTAGACCACGTGCTTGCCATGCTGCCCGAGCCCGCCTCGTGGAAGATTGTCGACGTCTTGTCCGGAAATTGCGAT
GGGGACTTGATACAGACACCTGCCGTCTCGCAGACTGTTTGCACGGCGCTGCAGATCGGACTCGTCGATCTCCTC
GCTTCGTGGTCGATTCTGCCTGCCGGCGTGGTGGGACATTCGTCGGGCGAAATCGCGGCGGCATATGCGGCGGGC
CACATCACCGCCGCGGAGGCGATCGTAATCGCCTCTTACCGTGGCGTCAGCGTCTCTTCGAGCACGAAGAAGGGT
GCAATGTTGGCCGTGGGTTTGAGCCACAGCCAGGGCGATGAGCGTATCAAGAATGCGGGCTTGGAGGACCAGGTC
AAGGTTGCTGCCATCAACTCCGGGGACAGCATCACCATGTCCGGCGATGCCGACGCTATCGGTGAGCTGTGTGCG
GAGCTGAACAGGGAGGACATATTCAACAGGCGGCTCCGGACAGGCGGACTTGCGTACCATTCTCACCATATGCTC
CCATTGAGCCGCGACTACGCCCAGGCAGTAGAAGCTGGACTTGAGGCGTTGGGCCCCTCCAGCGACGCTGAAAGA
TACCCCAGTGTCCCGTGGATTTCGACCGTCATGCCAGAAAAGAGCACGACAACCTCCCGGGAACGTGTGACGGCG
TCGTACTGGAAAGCCAATATGCAGTCCCCGGTGCGCTTCAGTGAGGCTGTGGCCAAGCTTCTCTGCCTCGACGAC
CTGGGGATCGGCGCCGTGGTGGAGATCGGTCCTCACCCGGCGCTCAAGAGCGCCTTGGAGCAGATCGTCAAGAAG
CTTGGCAAGACCGTTCCGCATGTCGCGTCGCTGAAGAGGGGCGTAGACGCCCGCAGATCGCTGCTGGACCTCGCT
GGCACTCTGTACGCCCTCAACGCCCCCGTCAACTTGACGGCAGTCAACGCCGTCGACGACGGGATGCGAGGGCTG
GCGCATGGCACCACGGCCGTCAACTTGCCGCCATATCAGTACAGATACGGTCCCATAAAGTACCACGAGAGCCGG
CTGAGTAGGGAATACCGCCTCCGTCGGGTTCCTCGCCATGATCTCCTGGGATCCAAGGTGGCCGGCACCGCCAGG
CTGCGTCCGCAGTGGCGAAACATTCTGCGCCTCAAGGACCTGCCCTGGCTGCACCACCACCGCATGCCGCCGCAC
GTCCTGCACCCCGGTGCCGCGCACATCGTCATGGCAATGGTGGCGGCCGAGCAGGCCTATGCCGAGCTCCCAGAC
GCGCTTTCCGTTGTGGGCTTCAGCCTCCGCAACGTTTCCATCAAGAGGACGCTGGTGGTTCCAGAGGACGACAAC
GGCATCGAGATCGTGCTCAGCCTGGAGCTTGAGGACGAAGCAACTGCTGGTTCACCGCGCTGGGCTGGTTTCTCC
ATCGCTTCCGTTGCCCGTGACTCGGACCAGTGGACCGAGCACTGCTCCGGCCTCGTCAAGGTCGAAGTCTCTGAC
TTTCAACAGGCGGCGCCAATCGACAAAGCAATGGACGGACGAGCCGTCGATGCGCAAAGGTGGCATAAGCGCTTT
GTGGAAATGGGCATGCTATTTGGCCCTTCTTTCCAAGGCCACGCGGATATTCGCGCCGATCCGAACAAGAATATC
GCTTCGGCCAAGCTGGCCCTCAAGACGACGGCGGGCATGTTCCCTGGCGGCGAGTCTAGCTACCCCATTCACCCG
GCTTCCCTCGATCTCGCCATCCGCCTTGGACTCATGGCCTGCCACGGCGGCCAGACAGAGACGGGCAGGGTCCAG
CTCCCCATCCACTTGAACCAGCTGCGGCTCAGGCACCGTTGCCTGCAGGGTCGCGACTGGGTCACCGGCATCTCA
CGCGGCGAGCTTTGCGGATTGCGCGGTGCGTGTGCCCAGCTGCAGATACTGGACGACGCAGGTGATGTCGCCCTG
GACGTTGACATGATGCGCTTCACCAGCCTCGACAACGAGGACTCATCCTTCCGCAGCAGTGGCCCGTCGAGCAAG
GCGTATGCCAGTCCCTTTGCGCGCCTTGTCTGGAGGCCCGACGTCCGCACACTGAGCGCGAGCCAGCGCCGAGCC
TTGTTCTCGCCCTCGGGGGGGAGCTCCGGGGGGGGCATCGGCGCTTTTCCACAGCTGTCTCACATCTTCGACTTG
CTGGGCCACGCCGAGCCCGATCTCCGAGTCCTAGAACTGGGCGGCGGCGGCGATACGGGCGCTGCGCAGGTCGCC
CTGAAGACGCTCGTAGGTGCCAACGGGATCAAGCGGTACCGGAAATTCGCCGTGACCGACGTCTCCCAGGAGCGG
CTTGCATCGGCCCGCCAGTCGACGTCGGAGTTCGGCGACATCAGTTATTCCGTTCTGGACATCAACGACGATCCG
CTGCAGCAGGGCTTCCGGCCAGCCAGCTACGACGTCGTCCTCTGGCCGAAGGCTCCTGTGGCCACTCACGACGCG
CTCGAAAACTGCCGGAAGCTCATCAGGCCGCGCGGGAGCATCATCCTGGTCGAACCCGCCGAGGATCATGCTGGC
GTCTCTCGGGATGACGCCCTACAAAAGGCTGGTTTTGCGCGGGGTCTTGAGCTGACAGTGGACGAGCCGGACCGC
CACTCCACCGTCGTCTTTTCCGCTTTGCATGATGAAGCCAGGCAGCACGGGAGGCAGATCCCAGTGGTGAGTCTC
CTCCACGGTGCCAAGGGCCCCCCGGCGCTGGTGACCCATCTGGCTCGGGCCATGGAAGAACGGGGACTGTGCCCC
AAGATCATGCCGCTTGATCGTGCGCACGATACCGTACCGCCTAATTCCCGTGTGGTGGCGTTCTTGGACTGTGAA
AATCTCTTGCTCGATGCCGACCAGCGCCGTCTTGGGCTTTTCCAGCACCTTGCCGCAAATGCCGCCAGCATGGTT
TGGATCACGTCGTGCGGCATGGTCAAAGGCCGCAATCCCGACGGCGCCCTCGTAGCCGGCCTGCTGCGGACACTG
GGGACAGAGAATCCAGCGGGTCAATTTCTCTCCGTTGACGTAGATGCTGAGGACTTCGACGTCGACGAGGATGAC
GTGGGCGAGCTGGTACGCTGCTTGATCGATCAAGAGCTCGCGCTGCAAGGAGCAGGCGGCGACAGCGCCGTAAAC
CGCGAGCTAGCCTGGCAGGACGGTTGCATGTGGATCAGCCGGATTGTTCCCGACGCCGAGCTCCAGGGCTACGCC
GAGGTGACAGACGCTCCGGATGACCACGACATGCAGATGGTGACCCTCGAAAGCCAGGGCCCCGTGTGCGCGGCC
TTTGGCACACCCGGTATACTGACCTCGCTCTACTTTCGAGCCTACAGGGAGCTCTGGAAACCTTTGGCTCGAGAT
CATATCGAGGTCAAGGTGGACGCCGTTGGCCTCAACTGGAAGGACCTTGGCGTCTGTTCCGGCCGTCTCGATCAG
AACAACTTCTCCAACGAGTACTGCGGCACCGTAGCCAAGAAAGGATTCGACGTGACCGGCTTCGAGGTCGGCGAC
CGGGTCTACGGCATGGGAAAGGGGCACTTCGGAAACTACACGCGAGTGCCGGCAGCACTCGGGCAGAAGCTGCGG
CCCGATGCCGACACGATCGAGGTTGCCACCATGCCTGTGGCATACATGACCGCTGTATATGCTTTCGAACACGTC
ACTCGTCTGAGACGTGGGCAGAAGGTGTTGATCCAGTCCGCCTCGGGCGGCCTCGGGCTCGCGGCCATCCAGCTG
GCGCGCTCAAAGGGCGCTGACATCTTCGTCACAGCCGGCACGTCGGAAAAGGCTCGCTTTTTGACCGAGAGCATG
GGCATTTCGCCCACCAAAGTCTTTTCCTCGCGCGATCCTGCCGACCTGTTGCGCATGGTTGGTGCGACTAAGAAC
GGTGGATTCGACGTCGTCCTCAGCACCGCCCAAGGCGACATGCTGCATGAGTCCATCAAGGCGCTGGCGCCGCTG
GGCCACCTAGTCGACGTCGGCCGGCTCGATGTCACGAGCTCCAAGAACGTTGCGCTGGATCTCTTCCAGAAGAGC
GCCACCTTTACCTCGTTCGATCTCGGCCTCGTAGTGGATCGCGACGCCGGCCTCGGCCAAGAACTTATGCGGGCG
GTGGACGAGCATTGGCGCGCCGGTCGCATAGGGCCCATTCGGCCTCACACGGTGTCGGACCTTTCACAGCTCGAC
CAGGTGCTTCTCCAGTTTTCAAAGGGCAAGCACATCGGGAAGATGGTGATATCGTACCAGAATCCCAGCTCCATC
GTCAAGATGCATCAGTCGGTCTCCCCCGCTCATTTCGACCCGGAAGCTCGCTATATCTTGGTCGGCGGGCTAAGC
GGTCTTGGGCGGACCATCGTCAGGTGGATGTGTGATCGCGGTGCTCGGGACCTGGTCGTCTGGTCCAGGAGCGGT
GCCGACCGTCTCGATCCTGAAGCGGTGGCGCTTATCGACGAGCTCGCGGCTCAGGGTGTGCGGATACAGCCGGTG
ACCTGCGACGTGAGCCAGCGGGAGCAGGTGGTACGGGCCGTACAAGACGCCAACGCCGACAGGATCGTACGTGGA
GTCCTCCACTTTGCCGTATCTTACCAGGACATCTCGTTCGACAAGATGACGGAGGACAAGTTCCACCAAGGCATA
GCAGCCAAGGTGTTGGGGACAAGGAATCTCGATGAGGCGACAGCCTCGTTGCCCCTCGACTTTTTCGTCATGACC
TCATCCCTCGGCACCGTATATGCTTTCCCCACGCAGAGCGCCTACCTGGCAGCAAACAACTTCCTGGACTACTTT
GCGCGTTACCGCCGGCGGCGTGGGCTGCCGGCGTCGACCGTGTCTCTGGGCTTCATCAACGACCTGGGTCCCCTG
GCCCAGGACCCCATGACCGTAAATCTGTTCGTGCGCACCAGGGGCCAGACCGTGACGGGGAGCCAGGTCTTGCGC
CTGCTGGAGCCAGCCTTTATGAGCCAGCACAAGGGTCGCCGTGAATGGCTCGGCCGCTCCCAAGATCCGCTATCG
GAAGCCAACATCATCACCGGCATGGACCCAGCAGCCTTCGTAACGATGAGACGAGACGAGGCCATGGGAGGCCCC
GTGCCCAGGTGGTACCACGATGCGCGCGCCTCTCTGATGCTACGCGCTCAGGACGACGCCTGGCGCCACCACAAC
GAAGCCAGCGGCGTCAAGGGCGCACAGGAGCTGGACGCCGCCGCCGACGAGTCCCCCACAGCACAGCTGCGACGG
CGGTTCGAGGCTTCGATCAATAGGCTCCGCACCACAGACGGTGGAGACGACAAGGAGCAGCGGGCCGAGGCGGTC
GGACTCGTAACGGACGCCGTCCAGGCAGCAGTGGCGAGACTGCTATTCGTGGATCCGTCGGCCGTGGATGCGGCC
AACACGGTGGTGGAACTGGGCATCGACAGTCTGCTAGCGGCCGAGTTCCGAAGCTGGCTGCGCGCCGCCTTCGGC
AAGAACATCAGCATGCTGGACCTGATGGATGCGAGGACCAAGATCCACGTGCTGGCGCGGACCGTCGTGGACGAG
GCGGTCAGGCCGTAG
Gene >Hirsu2|1531
CTGAGGGAGTTGCTCAGGGAGCAGAGAGACGTGCAGGTTGAGTTCGCGGAGCCGCGCTTCTCGGCCCGGGGCTTC
CATCACCCAGATGCGGACCGTCCCGGAACGGCCGTGGCCGGCAGCGGTTTTCTGCTCGACGAGGATCCGCGGCTG
TTTGACACCTCCTTCTTCGGTATTACCGACCTAGAGGCCGAGACCATGGACGCGTCGCAGCGCAAGCTCCTCGAG
GTGACGTACGAGGCCTTCGAGAACGCGGGCGAGACGTGGGAAAGCGTCTCGGGCGCCCGAGTCGGCGTCTTCGTC
GGCGACATCTCCTTGGACGGATACCTTGCCCAGGCCAAGGATTGGGAGAACAGCTCCAGGTACTCGGCCACGGGG
GCGTTCCCCAACATGCTGGCCAACCGCCTCCACTACGTCTTCAACCTCAAAGGGCCGAGCCTCGTCGTCAACAGC
GCGTGCACGTCGGCCATGTACGCCCTCCATCTTGCCGTCGCCTCGATGCGCAACGGCGACTGCGACTCAGCCGTG
GTTGCGGGCTCCAACTGGATCGTCGACCCGAGCTGTCACATGGCTATGGGCAAGCTGGGCGCCCTGTCGCCCACC
TCGAGGAGCCACACCTTTGACGCGTCTGCCGACGGCTACGCCCGTGGCGAGGGCTTCGTCGCGCTCTACCTGAAG
ACGTCCTCGCAGGCGATTCGGGACGCCGCTCCGATCCGCGCCCTGATCGTGGGGACCGCCGTCAATGCCAACGGC
CGGACGAACGGTATCGTTAGCCCGAGCGGCCCTGCGCAGGAGAGTGTCATTCGCGAGGCGTGAGTGAGTGGGCGG
GTTCCGTCTCCGCACATGGCGCTGACTCGTTGCATAGCTACAAGAACGCGGGCGGCCTTGATCCTTCGGAAACGA
TGTTCCTCGAGTGCCACGGCACAGGCACGCAAGTTGGAGATCCTGTCGAGGTGACAGCGGCCGGCAACGTCTTCG
GAATTGCGAGGTCGGATGCGTATCAGGACCGCCTGCTGATGGGGTCTATCAAAACTAACCTGGGCCATTTAGAGG
GCGCCTGCGCGCTTCCAGGAATTCTTAAGGTCGTGGCCGCCCTCGAGGCCGGCGAGATACCGCCCACCCTCGGCT
TTAAGACGCCAAACCCACGTATCGACTTCGACAAGGCCAAGGCCAGGGTAGTAGCGGATGTCGAGCCCTGGCCGG
AAAATAGACTGAAGCGGGCAAGTGTCACGTCTGCGGGCTTTGGCGGAACAAACGGCCACTGCATAATCGATCATG
TTCTTAAGGTGGTGCCGCGCTACCTTAAGCCGGGCATCCTCGCTCAGCATCCCGGGGCATCACTTGGCGGCCACG
GGGCAAGCGAACACGGGGCCAACGGCTCGAATGGCCACCGGCCGCAACATCGCCCGATAACTAACACGCCGACCA
TGGCCAGGAAAGCCGAGGTCACCACCCGTCAACTCGTGCTTCTCCCGTTCTCGGCGCATAACAAGGCCTCGCTTG
CCGCAAATATAGAGGCGTTATTCCGCGTTCTCGACCAGCACTCGCTGCCCGACGTGGCCTATACTCTGGCCGCCA
AGCGCTCGCGCTTCTCCCAGCGAGCCTTTCACATAGTAGACAAGGACGATCTCGGGCAGACCGCTCGGGGGAATG
GGCCCCAGATCTTCTCCTCACCCCAGCAGGTGCGCATAGGCTTCGTCTTCACGGGCCAAGGTGCCCAGTGGCAGG
CCATGGGGGCCGAGCTCTTCGAGTACGCCATATTCCGAGACGCCATGTCCTACCTAGACCACGTGCTTGCCATGC
TGCCCGAGCCCGCCTCGTGGAAGATTGTCGACGTCTTGTCCGGAAATTGCGATGGGGACTTGATACAGACACCTG
CCGTCTCGCAGACTGTTTGCACGGCGCTGCAGATCGGACTCGTCGATCTCCTCGCTTCGTGGTCGATTCTGCCTG
CCGGCGTGGTGGGACATTCGTCGGGCGAAATCGCGGCGGCATATGCGGCGGGCCACATCACCGCCGCGGAGGCGA
TCGTAATCGCCTCTTACCGTGGCGTCAGCGTCTCTTCGAGCACGAAGAAGGGTGCAATGTTGGCCGTGGGTTTGA
GCCACAGCCAGGGCGATGAGCGTATCAAGAATGCGGGCTTGGAGGACCAGGTCAAGGTTGCTGCCATCAACTCCG
GGGACAGCATCACCATGTCCGGCGATGCCGACGCTATCGGTGAGCTGTGTGCGGAGCTGAACAGGGAGGACATAT
TCAACAGGCGGCTCCGGACAGGCGGACTTGCGTACCATTCTCACCATATGCTCCCATTGAGCCGCGACTACGCCC
AGGCAGTAGAAGCTGGACTTGAGGCGTTGGGCCCCTCCAGCGACGCTGAAAGATACCCCAGTGTCCCGTGGATTT
CGACCGTCATGCCAGAAAAGAGCACGACAACCTCCCGGGAACGTGTGACGGCGTCGTACTGGAAAGCCAATATGC
AGTCCCCGGTGCGCTTCAGTGAGGCTGTGGCCAAGCTTCTCTGCCTCGACGACCTGGGGATCGGCGCCGTGGTGG
AGATCGGTCCTCACCCGGCGCTCAAGAGCGCCTTGGAGCAGATCGTCAAGAAGCTTGGCAAGACCGTTCCGCATG
TCGCGTCGCTGAAGAGGGGCGTAGACGCCCGCAGATCGCTGCTGGACCTCGCTGGCACTCTGTACGCCCTCAACG
CCCCCGTCAACTTGACGGCAGTCAACGCCGTCGACGACGGGATGCGAGGGCTGGCGCATGGCACCACGGCCGTCA
ACTTGCCGCCATATCAGTACAGATACGGTCCCATAAAGTACCACGAGAGCCGGCTGAGTAGGGAATACCGCCTCC
GTCGGGTTCCTCGCCATGATCTCCTGGGATCCAAGGTGGCCGGCACCGCCAGGCTGCGTCCGCAGTGGCGAAACA
TTCTGCGCCTCAAGGACCTGCCCTGGCTGCACCACCACCGCATGCCGCCGCACGTCCTGCACCCCGGTGCCGCGC
ACATCGTCATGGCAATGGTGGCGGCCGAGCAGGCCTATGCCGAGCTCCCAGACGCGCTTTCCGTTGTGGGCTTCA
GCCTCCGCAACGTTTCCATCAAGAGGACGCTGGTGGTTCCAGAGGACGACAACGGCATCGAGATCGTGCTCAGCC
TGGAGCTTGAGGACGAAGCAACTGCTGGTTCACCGCGCTGGGCTGGTTTCTCCATCGCTTCCGTTGCCCGTGACT
CGGACCAGTGGACCGAGCACTGCTCCGGCCTCGTCAAGGTCGAAGTCTCTGACTTTCAACAGGCGGCGCCAATCG
ACAAAGCAATGGACGGACGAGCCGTCGATGCGCAAAGGTGGCATAAGCGCTTTGTGGAAATGGGCATGCTATTTG
GCCCTTCTTTCCAAGGCCACGCGGATATTCGCGCCGATCCGAACAAGAATATCGCTTCGGCCAAGCTGGCCCTCA
AGACGACGGCGGGCATGTTCCCTGGCGGCGAGTCTAGCTACCCCATTCACCCGGCTTCCCTCGATCTCGCCATCC
GCCTTGGACTCATGGCCTGCCACGGCGGCCAGACAGAGACGGGCAGGGTCCAGCTCCCCATCCACTTGAACCAGC
TGCGGCTCAGGCACCGTTGCCTGCAGGGTCGCGACTGGGTCACCGGCATCTCACGCGGCGAGCTTTGCGGATTGC
GCGGTGCGTGTGCCCAGCTGCAGATACTGGACGACGCAGGTGATGTCGCCCTGGACGTTGACATGATGCGCTTCA
CCAGCCTCGACAACGAGGACTCATCCTTCCGCAGCAGTGGCCCGTCGAGCAAGGCGTATGCCAGTCCCTTTGCGC
GCCTTGTCTGGAGGCCCGACGTCCGCACACTGAGCGCGAGCCAGCGCCGAGCCTTGTTCTCGCCCTCGGGGGGGA
GCTCCGGGGGGGGCATCGGCGCTTTTCCACAGCTGTCTCACATCTTCGACTTGCTGGGCCACGCCGAGCCCGATC
TCCGAGTCCTAGAACTGGGCGGCGGCGGCGATACGGGCGCTGCGCAGGTCGCCCTGAAGACGCTCGTAGGTGCCA
ACGGGATCAAGCGGTACCGGAAATTCGCCGTGACCGACGTCTCCCAGGAGCGGCTTGCATCGGCCCGCCAGTCGA
CGTCGGAGTTCGGCGACATCAGTTATTCCGTTCTGGACATCAACGACGATCCGCTGCAGCAGGGCTTCCGGCCAG
CCAGCTACGACGTCGTCCTCTGGCCGAAGGCTCCTGTGGCCACTCACGACGCGCTCGAAAACTGCCGGAAGCTCA
TCAGGCCGCGCGGGAGCATCATCCTGGTCGAACCCGCCGAGGATCATGCTGGCGTCTCTCGGGATGACGCCCTAC
AAAAGGCTGGTTTTGCGCGGGGTCTTGAGCTGACAGTGGACGAGCCGGACCGCCACTCCACCGTCGTCTTTTCCG
CTTTGCATGATGAAGCCAGGCAGCACGGGAGGCAGATCCCAGTGGTGAGTCTCCTCCACGGTGCCAAGGGCCCCC
CGGCGCTGGTGACCCATCTGGCTCGGGCCATGGAAGAACGGGGACTGTGCCCCAAGATCATGCCGCTTGATCGTG
CGCACGATACCGTACCGCCTAATTCCCGTGTGGTGGCGTTCTTGGACTGTGAAAATCTCTTGCTCGATGCCGACC
AGCGCCGTCTTGGGCTTTTCCAGCACCTTGCCGCAAATGCCGCCAGCATGGTTTGGATCACGTCGTGCGGCATGG
TCAAAGGCCGCAATCCCGACGGCGCCCTCGTAGCCGGCCTGCTGCGGACACTGGGGACAGAGAATCCAGCGGGTC
AATTTCTCTCCGTTGACGTAGATGCTGAGGACTTCGACGTCGACGAGGATGACGTGGGCGAGCTGGTACGCTGCT
TGATCGATCAAGAGCTCGCGCTGCAAGGAGCAGGCGGCGACAGCGCCGTAAACCGCGAGCTAGCCTGGCAGGACG
GTTGCATGTGGATCAGCCGGATTGTTCCCGACGCCGAGCTCCAGGGCTACGCCGAGGTGACAGACGCTCCGGATG
ACCACGACATGCAGATGGTGACCCTCGAAAGCCAGGGCCCCGTGTGCGCGGCCTTTGGCACACCCGGTATACTGA
CCTCGCTCTACTTTCGAGCCTACAGGGAGCTCTGGAAACCTTTGGCTCGAGATCATATCGAGGTCAAGGTGGACG
CCGTTGGCCTCAACTGGAAGGACCTTGGCGTCTGTTCCGGCCGTCTCGATCAGAACAACTTCTCCAACGAGTACT
GCGGCACCGTAGCCAAGAAAGGATTCGACGTGACCGGCTTCGAGGTCGGCGACCGGGTCTACGGCATGGGAAAGG
GGCACTTCGGAAACTACACGCGAGTGCCGGCAGCACTCGGGCAGAAGCTGCGGCCCGATGCCGACACGATCGAGG
TTGCCACCATGCCTGTGGCATACATGACCGCTGTATATGCTTTCGAACACGTCACTCGTCTGAGACGTGGGCAGA
AGGTGTTGATCCAGTCCGCCTCGGGCGGCCTCGGGCTCGCGGCCATCCAGCTGGCGCGCTCAAAGGGCGCTGACA
TCTTCGTCACAGCCGGCACGTCGGAAAAGGCTCGCTTTTTGACCGAGAGCATGGGCATTTCGCCCACCAAAGTCT
TTTCCTCGCGCGATCCTGCCGACCTGTTGCGCATGGTTGGTGCGACTAAGAACGGTGGATTCGACGTCGTCCTCA
GCACCGCCCAAGGCGACATGCTGCATGAGTCCATCAAGGCGCTGGCGCCGCTGGGCCACCTAGTCGACGTCGGCC
GGCTCGATGTCACGAGCTCCAAGAACGTTGCGCTGGATCTCTTCCAGAAGAGCGCCACCTTTACCTCGTTCGATC
TCGGCCTCGTAGTGGATCGCGACGCCGGCCTCGGCCAAGAACTTATGCGGGCGGTGGACGAGCATTGGCGCGCCG
GTCGCATAGGGCCCATTCGGCCTCACACGGTGTCGGACCTTTCACAGCTCGACCAGGTGCTTCTCCAGTTTTCAA
AGGGCAAGCACATCGGGAAGATGGTGATATCGTACCAGAATCCCAGCTCCATCGTCAAGATGCATCAGTCGGTCT
CCCCCGCTCATTTCGACCCGGAAGCTCGCTATATCTTGGTCGGCGGGCTAAGCGGTCTTGGGCGGACCATCGTCA
GGTGGATGTGTGATCGCGGTGCTCGGGACCTGGTCGTCTGGTCCAGGAGCGGTGCCGACCGTCTCGATCCTGAAG
CGGTGGCGCTTATCGACGAGCTCGCGGCTCAGGGTGTGCGGATACAGCCGGTGACCTGCGACGTGAGCCAGCGGG
AGCAGGTGGTACGGGCCGTACAAGACGCCAACGCCGACAGGATCGTACGTGGAGTCCTCCACTTTGCCGTATCTT
ACCAGGACATCTCGTTCGACAAGATGACGGAGGACAAGTTCCACCAAGGCATAGCAGCCAAGGTGTTGGGGACAA
GGAATCTCGATGAGGCGACAGCCTCGTTGCCCCTCGACTTTTTCGTCATGACCTCATCCCTCGGCACCGTATATG
CTTTCCCCACGCAGAGCGCCTACCTGGCAGCAAACAACTTCCTGGACTACTTTGCGCGTTACCGCCGGCGGCGTG
GGCTGCCGGCGTCGACCGTGTCTCTGGGCTTCATCAACGACCTGGGTCCCCTGGCCCAGGACCCCATGACCGTAA
ATCTGTTCGTGCGCACCAGGGGCCAGACCGTGACGGGGAGCCAGGTCTTGCGCCTGCTGGAGCCAGCCTTTATGA
GCCAGCACAAGGGTCGCCGTGAATGGCTCGGCCGCTCCCAAGATCCGCTATCGGAAGCCAACATCATCACCGGCA
TGGACCCAGCAGCCTTCGTAACGATGAGACGAGACGAGGCCATGGGAGGCCCCGTGCCCAGGTGGTACCACGATG
CGCGCGCCTCTCTGATGCTACGCGCTCAGGACGACGCCTGGCGCCACCACAACGAAGCCAGCGGCGTCAAGGGCG
CACAGGAGCTGGACGCCGCCGCCGACGAGTCCCCCACAGCACAGCTGCGACGGCGGTTCGAGGCTTCGATCAATA
GGCTCCGCACCACAGACGGTGGAGACGACAAGGAGCAGCGGGCCGAGGCGGTCGGACTCGTAACGGACGCCGTCC
AGGCAGCAGTGGCGAGACTGCTATTCGTGGATCCGTCGGCCGTGGATGCGGCCAACACGGTGGTGGAACTGGGCA
TCGACAGTCTGCTAGCGGCCGAGTTCCGAAGCTGGCTGCGCGCCGCCTTCGGCAAGAACATCAGCATGCTGGACC
TGATGGATGCGAGGACCAAGATCCACGTGCTGGCGCGGACCGTCGTGGACGAGGCGGTCAGGCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail