Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1515
Gene name
LocationContig_1335:789..2187
Strand-
Gene length (bp)1398
Transcript length (bp)1296
Coding sequence length (bp)1296
Protein length (aa) 432

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03388 Lectin_leg-like Legume-like lectin family 1.8E-23 60 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P43555|EMP47_YEAST Protein EMP47 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP47 PE=1 SV=1 11 236 9.0E-19
sp|Q2HJD1|LMA2L_BOVIN VIP36-like protein OS=Bos taurus GN=LMAN2L PE=2 SV=1 60 238 6.0E-09
sp|Q5RCF0|LMA2L_PONAB VIP36-like protein OS=Pongo abelii GN=LMAN2L PE=3 SV=1 60 238 1.0E-08
sp|Q9H0V9|LMA2L_HUMAN VIP36-like protein OS=Homo sapiens GN=LMAN2L PE=1 SV=1 60 238 1.0E-08
sp|P59481|LMA2L_MOUSE VIP36-like protein OS=Mus musculus GN=Lman2l PE=1 SV=1 60 253 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P43555|EMP47_YEAST Protein EMP47 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP47 PE=1 SV=1 11 236 9.0E-19
sp|Q2HJD1|LMA2L_BOVIN VIP36-like protein OS=Bos taurus GN=LMAN2L PE=2 SV=1 60 238 6.0E-09
sp|Q5RCF0|LMA2L_PONAB VIP36-like protein OS=Pongo abelii GN=LMAN2L PE=3 SV=1 60 238 1.0E-08
sp|Q9H0V9|LMA2L_HUMAN VIP36-like protein OS=Homo sapiens GN=LMAN2L PE=1 SV=1 60 238 1.0E-08
sp|P59481|LMA2L_MOUSE VIP36-like protein OS=Mus musculus GN=Lman2l PE=1 SV=1 60 253 2.0E-08
sp|Q9HAT1|LMA1L_HUMAN Protein ERGIC-53-like OS=Homo sapiens GN=LMAN1L PE=2 SV=2 63 245 2.0E-07
sp|O42707|YOC5_SCHPO L-type lectin-like domain-containing protein C4F6.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.05c PE=2 SV=2 77 238 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 397 419 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1515
MRGPALSSALAALLAAHGCRSEALIPELSFGHSGRLIPEDGPAGRIPHFAVSGQPWQPELLSNKVILTPVAPGNM
RGAVWAEAPLERSVWTAEVEFRATGAERGGGNLNVWLAAQGARAVGSNSIYTVGKFDGLALVVDSHGGAGGMVRG
FLNDGSVDFKQQSSVDRLAFGHCAYAYRNLGRPSVLRLRQSHDSFRLDVDGHACFETDKVSVPSGYHWGVTAATP
DNPDSFELFKLVVSSDSTVSSGADKAEHHHAAAAAAAHHEHEAPQKQSQPPPPPPPDEPAAHFKTSQAQFEDLHN
RLQGLMHHVSGAWAAVTELQRQAEQRHGETAAALDGLRRARDDAGDVPQRLRELEREVRAMRSDINAKLAAHHDS
LQGYLTDHHATLAGTVARAVPGHGRLILVFVGSQLLLVAAYVVYKRRRASSPKKYL*
Coding >Hirsu2|1515
ATGCGAGGACCGGCCCTGTCGTCGGCGCTGGCCGCGCTGTTGGCCGCCCATGGCTGCCGTTCCGAGGCGCTCATC
CCCGAGCTCAGCTTCGGCCATTCCGGACGATTGATCCCCGAAGACGGCCCCGCCGGACGGATCCCGCACTTCGCC
GTGTCCGGGCAGCCGTGGCAGCCGGAGCTGCTGTCGAACAAGGTGATACTGACGCCCGTGGCGCCGGGCAACATG
CGCGGGGCGGTGTGGGCGGAGGCGCCGCTGGAGCGCAGCGTGTGGACGGCCGAGGTCGAGTTCCGGGCGACCGGG
GCGGAGCGCGGCGGCGGCAACCTCAACGTGTGGCTGGCGGCGCAGGGCGCGCGCGCCGTCGGCAGCAACAGCATC
TACACGGTCGGCAAGTTCGACGGGCTGGCGCTCGTCGTCGACTCGCACGGCGGCGCCGGCGGCATGGTGCGCGGC
TTCCTCAACGACGGCAGCGTCGACTTCAAGCAGCAGTCGAGCGTCGACCGGCTGGCCTTTGGCCACTGCGCCTAC
GCCTACCGCAACCTGGGCCGGCCGTCGGTCCTGCGCCTGCGCCAGAGCCACGACAGCTTCCGCCTCGACGTCGAC
GGCCACGCCTGCTTCGAGACGGACAAGGTCAGCGTCCCGTCCGGCTACCACTGGGGCGTCACGGCCGCGACGCCC
GACAACCCGGACTCGTTCGAGCTCTTCAAGCTCGTCGTCAGCTCCGACTCGACCGTCTCCAGCGGCGCTGACAAG
GCCGAGCACCACCACGCCGCCGCCGCCGCCGCCGCCCACCACGAGCACGAGGCGCCGCAGAAGCAGTCGCAGCCG
CCGCCGCCGCCGCCGCCCGACGAGCCGGCCGCGCACTTCAAGACGTCGCAGGCCCAGTTCGAGGACCTGCACAAC
CGGCTGCAGGGCCTGATGCACCACGTCTCGGGCGCCTGGGCCGCCGTGACGGAGCTGCAGCGCCAGGCGGAGCAG
CGCCACGGCGAGACGGCGGCGGCGCTCGACGGCCTGCGCCGCGCCCGCGACGACGCCGGCGACGTGCCGCAGCGC
CTGCGCGAGCTCGAGCGCGAGGTGCGCGCCATGCGCAGCGACATCAACGCCAAGCTGGCCGCCCACCACGACTCG
CTGCAGGGCTACCTCACCGACCACCACGCCACCCTGGCCGGCACCGTCGCCCGCGCCGTCCCCGGCCACGGCCGC
CTCATCCTCGTCTTCGTCGGCAGCCAGCTGCTCCTCGTCGCCGCCTACGTAGTCTACAAGCGCCGCCGCGCCAGC
AGCCCCAAGAAGTATCTCTGA
Transcript >Hirsu2|1515
ATGCGAGGACCGGCCCTGTCGTCGGCGCTGGCCGCGCTGTTGGCCGCCCATGGCTGCCGTTCCGAGGCGCTCATC
CCCGAGCTCAGCTTCGGCCATTCCGGACGATTGATCCCCGAAGACGGCCCCGCCGGACGGATCCCGCACTTCGCC
GTGTCCGGGCAGCCGTGGCAGCCGGAGCTGCTGTCGAACAAGGTGATACTGACGCCCGTGGCGCCGGGCAACATG
CGCGGGGCGGTGTGGGCGGAGGCGCCGCTGGAGCGCAGCGTGTGGACGGCCGAGGTCGAGTTCCGGGCGACCGGG
GCGGAGCGCGGCGGCGGCAACCTCAACGTGTGGCTGGCGGCGCAGGGCGCGCGCGCCGTCGGCAGCAACAGCATC
TACACGGTCGGCAAGTTCGACGGGCTGGCGCTCGTCGTCGACTCGCACGGCGGCGCCGGCGGCATGGTGCGCGGC
TTCCTCAACGACGGCAGCGTCGACTTCAAGCAGCAGTCGAGCGTCGACCGGCTGGCCTTTGGCCACTGCGCCTAC
GCCTACCGCAACCTGGGCCGGCCGTCGGTCCTGCGCCTGCGCCAGAGCCACGACAGCTTCCGCCTCGACGTCGAC
GGCCACGCCTGCTTCGAGACGGACAAGGTCAGCGTCCCGTCCGGCTACCACTGGGGCGTCACGGCCGCGACGCCC
GACAACCCGGACTCGTTCGAGCTCTTCAAGCTCGTCGTCAGCTCCGACTCGACCGTCTCCAGCGGCGCTGACAAG
GCCGAGCACCACCACGCCGCCGCCGCCGCCGCCGCCCACCACGAGCACGAGGCGCCGCAGAAGCAGTCGCAGCCG
CCGCCGCCGCCGCCGCCCGACGAGCCGGCCGCGCACTTCAAGACGTCGCAGGCCCAGTTCGAGGACCTGCACAAC
CGGCTGCAGGGCCTGATGCACCACGTCTCGGGCGCCTGGGCCGCCGTGACGGAGCTGCAGCGCCAGGCGGAGCAG
CGCCACGGCGAGACGGCGGCGGCGCTCGACGGCCTGCGCCGCGCCCGCGACGACGCCGGCGACGTGCCGCAGCGC
CTGCGCGAGCTCGAGCGCGAGGTGCGCGCCATGCGCAGCGACATCAACGCCAAGCTGGCCGCCCACCACGACTCG
CTGCAGGGCTACCTCACCGACCACCACGCCACCCTGGCCGGCACCGTCGCCCGCGCCGTCCCCGGCCACGGCCGC
CTCATCCTCGTCTTCGTCGGCAGCCAGCTGCTCCTCGTCGCCGCCTACGTAGTCTACAAGCGCCGCCGCGCCAGC
AGCCCCAAGAAGTATCTCTGA
Gene >Hirsu2|1515
ATGCGAGGACCGGCCCTGTCGTCGGCGCTGGCCGCGCTGTTGGCCGCCCATGGCTGCCGTTCCGAGGCGCTCATC
CCCGAGCTCAGCTTCGGCCATTCCGGACGGTGAGTTTTTTTCTTGTCTCTCTGTCTCCCTCTGTCTCGCTCTCTC
GGTTGTTGCCCGGAAGCTAACGATGACGTCTTTTTTTTTTTTCTCCTCTCTTCAAGATTGATCCCCGAAGACGGC
CCCGCCGGACGGATCCCGCACTTCGCCGTGTCCGGGCAGCCGTGGCAGCCGGAGCTGCTGTCGAACAAGGTGATA
CTGACGCCCGTGGCGCCGGGCAACATGCGCGGGGCGGTGTGGGCGGAGGCGCCGCTGGAGCGCAGCGTGTGGACG
GCCGAGGTCGAGTTCCGGGCGACCGGGGCGGAGCGCGGCGGCGGCAACCTCAACGTGTGGCTGGCGGCGCAGGGC
GCGCGCGCCGTCGGCAGCAACAGCATCTACACGGTCGGCAAGTTCGACGGGCTGGCGCTCGTCGTCGACTCGCAC
GGCGGCGCCGGCGGCATGGTGCGCGGCTTCCTCAACGACGGCAGCGTCGACTTCAAGCAGCAGTCGAGCGTCGAC
CGGCTGGCCTTTGGCCACTGCGCCTACGCCTACCGCAACCTGGGCCGGCCGTCGGTCCTGCGCCTGCGCCAGAGC
CACGACAGCTTCCGCCTCGACGTCGACGGCCACGCCTGCTTCGAGACGGACAAGGTCAGCGTCCCGTCCGGCTAC
CACTGGGGCGTCACGGCCGCGACGCCCGACAACCCGGACTCGTTCGAGCTCTTCAAGCTCGTCGTCAGCTCCGAC
TCGACCGTCTCCAGCGGCGCTGACAAGGCCGAGCACCACCACGCCGCCGCCGCCGCCGCCGCCCACCACGAGCAC
GAGGCGCCGCAGAAGCAGTCGCAGCCGCCGCCGCCGCCGCCGCCCGACGAGCCGGCCGCGCACTTCAAGACGTCG
CAGGCCCAGTTCGAGGACCTGCACAACCGGCTGCAGGGCCTGATGCACCACGTCTCGGGCGCCTGGGCCGCCGTG
ACGGAGCTGCAGCGCCAGGCGGAGCAGCGCCACGGCGAGACGGCGGCGGCGCTCGACGGCCTGCGCCGCGCCCGC
GACGACGCCGGCGACGTGCCGCAGCGCCTGCGCGAGCTCGAGCGCGAGGTGCGCGCCATGCGCAGCGACATCAAC
GCCAAGCTGGCCGCCCACCACGACTCGCTGCAGGGCTACCTCACCGACCACCACGCCACCCTGGCCGGCACCGTC
GCCCGCGCCGTCCCCGGCCACGGCCGCCTCATCCTCGTCTTCGTCGGCAGCCAGCTGCTCCTCGTCGCCGCCTAC
GTAGTCTACAAGCGCCGCCGCGCCAGCAGCCCCAAGAAGTATCTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail