Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1513
Gene name
LocationContig_1334:956..3480
Strand-
Gene length (bp)2524
Transcript length (bp)2205
Coding sequence length (bp)2205
Protein length (aa) 735

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 4.1E-47 65 560
PF07690 MFS_1 Major Facilitator Superfamily 1.5E-18 122 503

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 18 563 0.0E+00
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 21 561 3.0E-175
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 49 570 1.0E-97
sp|Q494P0|PHT17_ARATH Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2 49 565 3.0E-97
sp|Q8VYM2|PHT11_ARATH Inorganic phosphate transporter 1-1 OS=Arabidopsis thaliana GN=PHT1-1 PE=1 SV=2 49 569 9.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 18 563 0.0E+00
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 21 561 3.0E-175
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 49 570 1.0E-97
sp|Q494P0|PHT17_ARATH Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2 49 565 3.0E-97
sp|Q8VYM2|PHT11_ARATH Inorganic phosphate transporter 1-1 OS=Arabidopsis thaliana GN=PHT1-1 PE=1 SV=2 49 569 9.0E-96
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 49 564 3.0E-95
sp|O48639|PHT13_ARATH Probable inorganic phosphate transporter 1-3 OS=Arabidopsis thaliana GN=PHT1-3 PE=2 SV=1 49 566 4.0E-95
sp|Q8GYF4|PHT15_ARATH Probable inorganic phosphate transporter 1-5 OS=Arabidopsis thaliana GN=PHT1-5 PE=2 SV=2 44 565 9.0E-95
sp|Q8H6G9|PHT17_ORYSJ Probable inorganic phosphate transporter 1-7 OS=Oryza sativa subsp. japonica GN=PHT1-7 PE=2 SV=1 49 566 9.0E-95
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 49 565 1.0E-94
sp|Q01MW8|PHT14_ORYSI Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. indica GN=PHT1-4 PE=2 SV=2 49 565 4.0E-94
sp|Q7X7V2|PHT15_ORYSJ Probable inorganic phosphate transporter 1-5 OS=Oryza sativa subsp. japonica GN=PHT1-5 PE=2 SV=2 43 565 1.0E-93
sp|Q96303|PHT14_ARATH Inorganic phosphate transporter 1-4 OS=Arabidopsis thaliana GN=PHT1-4 PE=1 SV=1 44 562 1.0E-92
sp|Q9P6J9|YHD1_SCHPO Putative inorganic phosphate transporter C1683.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.01 PE=3 SV=1 63 586 1.0E-92
sp|Q7XDZ7|PHT13_ORYSJ Probable inorganic phosphate transporter 1-3 OS=Oryza sativa subsp. japonica GN=PHT1-3 PE=2 SV=1 49 564 9.0E-92
sp|O42885|YBN1_SCHPO Putative inorganic phosphate transporter C8E4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.01c PE=1 SV=2 61 586 2.0E-91
sp|Q94DB8|PT111_ORYSJ Inorganic phosphate transporter 1-11 OS=Oryza sativa subsp. japonica GN=PHT1-11 PE=2 SV=1 38 563 2.0E-91
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 49 581 3.0E-91
sp|Q8H6G8|PHT18_ORYSJ Probable inorganic phosphate transporter 1-8 OS=Oryza sativa subsp. japonica GN=PHT1-8 PE=2 SV=1 49 565 6.0E-91
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 41 565 7.0E-90
sp|Q96243|PHT12_ARATH Probable inorganic phosphate transporter 1-2 OS=Arabidopsis thaliana GN=PHT1-2 PE=2 SV=2 49 569 1.0E-88
sp|Q7XRH8|PT113_ORYSJ Putative inorganic phosphate transporter 1-13 OS=Oryza sativa subsp. japonica GN=PHT1-13 PE=3 SV=2 48 562 2.0E-84
sp|Q9S735|PHT19_ARATH Probable inorganic phosphate transporter 1-9 OS=Arabidopsis thaliana GN=PHT1-9 PE=2 SV=1 49 563 1.0E-83
sp|Q69T94|PT110_ORYSJ Probable inorganic phosphate transporter 1-10 OS=Oryza sativa subsp. japonica GN=PHT1-10 PE=2 SV=1 49 583 1.0E-83
sp|Q09852|YAEC_SCHPO Putative inorganic phosphate transporter C23D3.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23D3.12 PE=1 SV=1 36 564 2.0E-83
sp|Q9SYQ1|PHT18_ARATH Probable inorganic phosphate transporter 1-8 OS=Arabidopsis thaliana GN=PHT1-8 PE=2 SV=2 49 559 2.0E-83
sp|Q8H6H4|PHT11_ORYSJ Inorganic phosphate transporter 1-1 OS=Oryza sativa subsp. japonica GN=PHT1-1 PE=2 SV=1 49 563 6.0E-83
sp|Q9Y7Q9|YCX2_SCHPO Probable metabolite transporter C2H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC2H8.02 PE=1 SV=1 61 552 5.0E-82
sp|Q8H6G7|PHT19_ORYSJ Probable inorganic phosphate transporter 1-9 OS=Oryza sativa subsp. japonica GN=PHT1-9 PE=2 SV=2 49 575 4.0E-79
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 51 564 2.0E-22
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 67 558 7.0E-17
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 125 561 3.0E-14
sp|O94342|YHM9_SCHPO Probable metabolite transport protein C1271.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.09 PE=3 SV=1 61 501 4.0E-14
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 110 561 6.0E-14
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 124 575 5.0E-13
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 121 571 5.0E-13
sp|Q6PDF3|SVOPL_MOUSE Putative transporter SVOPL OS=Mus musculus GN=Svopl PE=2 SV=1 52 560 7.0E-13
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 67 560 1.0E-12
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 52 554 2.0E-12
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 26 561 3.0E-12
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 26 561 3.0E-12
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 26 561 3.0E-12
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 124 565 2.0E-11
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 26 575 2.0E-11
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 109 561 6.0E-11
sp|Q8N434|SVOPL_HUMAN Putative transporter SVOPL OS=Homo sapiens GN=SVOPL PE=2 SV=2 52 560 7.0E-11
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 60 315 9.0E-11
sp|O35956|S22A6_RAT Solute carrier family 22 member 6 OS=Rattus norvegicus GN=Slc22a6 PE=1 SV=1 124 565 2.0E-10
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 109 561 3.0E-10
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 109 561 3.0E-10
sp|Q8VC69|S22A6_MOUSE Solute carrier family 22 member 6 OS=Mus musculus GN=Slc22a6 PE=1 SV=1 124 508 3.0E-10
sp|Q7ZX53|S22FL_XENLA Solute carrier family 22 member 15-like OS=Xenopus laevis GN=slc22a15b PE=2 SV=1 124 559 3.0E-10
sp|A6QLW8|S22A7_BOVIN Solute carrier family 22 member 7 OS=Bos taurus GN=SLC22A7 PE=2 SV=1 115 508 5.0E-10
sp|Q1RPP5|S22A7_PIG Solute carrier family 22 member 7 OS=Sus scrofa GN=SLC22A7 PE=2 SV=1 115 508 5.0E-10
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 26 561 7.0E-10
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 135 561 8.0E-10
sp|Q8MK48|S22A6_PIG Solute carrier family 22 member 6 OS=Sus scrofa GN=SLC22A6 PE=1 SV=2 125 508 9.0E-10
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 115 508 1.0E-09
sp|Q4W8A3|S22A6_MACFA Solute carrier family 22 member 6 OS=Macaca fascicularis GN=SLC22A6 PE=1 SV=1 125 508 2.0E-09
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 118 560 2.0E-09
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 110 294 2.0E-09
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 110 294 2.0E-09
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 26 561 2.0E-09
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 110 294 2.0E-09
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 110 294 2.0E-09
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 110 294 2.0E-09
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 110 369 2.0E-09
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 129 578 2.0E-09
sp|Q46909|YGCS_ECOLI Inner membrane metabolite transport protein YgcS OS=Escherichia coli (strain K12) GN=ygcS PE=1 SV=2 120 226 3.0E-09
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 52 294 3.0E-09
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 64 561 3.0E-09
sp|Q28ES4|S22FL_XENTR Solute carrier family 22 member 15-like OS=Xenopus tropicalis GN=slc22a15b PE=2 SV=1 124 559 3.0E-09
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 65 573 4.0E-09
sp|Q4U2R8|S22A6_HUMAN Solute carrier family 22 member 6 OS=Homo sapiens GN=SLC22A6 PE=1 SV=1 125 508 5.0E-09
sp|P25346|GIT1_YEAST Probable metabolite transport protein GIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIT1 PE=1 SV=1 33 502 6.0E-09
sp|Q6NYN7|S22A6_DANRE Solute carrier family 22 member 6 OS=Danio rerio GN=slc22a6 PE=2 SV=1 115 506 6.0E-09
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 110 561 7.0E-09
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 110 561 7.0E-09
sp|Q5RCH6|S22A6_PONAB Solute carrier family 22 member 6 OS=Pongo abelii GN=SLC22A6 PE=2 SV=1 125 508 8.0E-09
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 125 294 9.0E-09
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 115 561 1.0E-08
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 48 561 1.0E-08
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 128 561 1.0E-08
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 109 569 1.0E-08
sp|Q9LHQ6|OCT4_ARATH Organic cation/carnitine transporter 4 OS=Arabidopsis thaliana GN=OCT4 PE=2 SV=1 124 552 2.0E-08
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 95 588 2.0E-08
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 95 588 2.0E-08
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 50 288 3.0E-08
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 95 588 4.0E-08
sp|Q5R540|S22A7_PONAB Solute carrier family 22 member 7 OS=Pongo abelii GN=SLC22A7 PE=2 SV=1 115 508 4.0E-08
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 128 561 4.0E-08
sp|Q5RLM2|S22A7_RAT Solute carrier family 22 member 7 OS=Rattus norvegicus GN=Slc22a7 PE=1 SV=1 125 497 4.0E-08
sp|Q9Y694|S22A7_HUMAN Solute carrier family 22 member 7 OS=Homo sapiens GN=SLC22A7 PE=1 SV=1 115 508 5.0E-08
sp|Q66KG0|S22AG_XENLA Solute carrier family 22 member 16 OS=Xenopus laevis GN=slc22a16 PE=2 SV=2 125 567 6.0E-08
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 60 560 7.0E-08
sp|P15729|GLCP_SYNY3 Glucose transport protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gtr PE=3 SV=2 175 560 7.0E-08
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 125 294 8.0E-08
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 48 506 9.0E-08
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 95 588 1.0E-07
sp|P0C0L7|PROP_ECOLI Proline/betaine transporter OS=Escherichia coli (strain K12) GN=proP PE=1 SV=1 63 362 2.0E-07
sp|P0C0L8|PROP_ECO57 Proline/betaine transporter OS=Escherichia coli O157:H7 GN=proP PE=3 SV=1 63 362 2.0E-07
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 110 525 2.0E-07
sp|P40862|PROP_SALTY Proline/betaine transporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proP PE=3 SV=2 63 362 3.0E-07
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 111 563 3.0E-07
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 118 561 3.0E-07
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 125 560 3.0E-07
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 115 560 3.0E-07
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 135 441 4.0E-07
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 134 565 4.0E-07
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 125 511 5.0E-07
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 144 568 6.0E-07
sp|Q5EXK5|MHBT_KLEOX 3-hydroxybenzoate transporter MhbT OS=Klebsiella oxytoca GN=mhbT PE=1 SV=1 134 318 6.0E-07
sp|Q9U539|OCT1_CAEEL Organic cation transporter 1 OS=Caenorhabditis elegans GN=oct-1 PE=1 SV=3 121 503 7.0E-07
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 109 569 7.0E-07
sp|O30513|BENK_ACIAD Benzoate transport protein OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=benK PE=3 SV=2 52 315 9.0E-07
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 115 562 1.0E-06
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 123 560 2.0E-06
sp|Q66J54|S226A_XENLA Solute carrier family 22 member 6-A OS=Xenopus laevis GN=slc22a6-a PE=2 SV=1 125 508 2.0E-06
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 136 560 2.0E-06
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 118 561 2.0E-06
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 63 566 2.0E-06
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 174 560 2.0E-06
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 77 560 3.0E-06
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 115 495 3.0E-06
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 118 561 5.0E-06
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 134 565 5.0E-06
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 33 287 5.0E-06
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 179 561 7.0E-06
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 104 560 8.0E-06
sp|Q3YAW7|S22A7_RABIT Solute carrier family 22 member 7 OS=Oryctolagus cuniculus GN=SLC22A7 PE=2 SV=1 125 508 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 57 74 17
2 79 96 17
3 120 137 17
4 150 169 19
5 174 196 22
6 209 231 22
7 259 281 22
8 359 381 22
9 396 418 22
10 425 447 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1513
MAGSHDGSLPPRMAFRGPDRTYGGNRAFHNFYNDYSHIPDANLRRRLALSEIDKVPFGLYHVRAVLVAGVGFLLD
SYDIFAINVVVTLLGLVFWSGEHNEDGYGGHGGVLPDSTNQALKGSTSAGIIIGMVVFGWLADALGRRKMYGIEL
AIIIFGTFSCALASSSPAISSSAILIFWRVLMGIGIGGDYPLSCVITSEFAPTRWRGAMVAAVFSMQGLGLVLSA
LVALITTVAFKDSFLHVKDETQCDAACRAAADRSWRIIVGVGAIPACLALYYRITIPETPRYTFDVRHDVEKAGA
DIRAYVQSKSSGEYEGHRGARSRISETLLNVPRASWSDLVAYFARWKNLRVLVGTTASWFLLDLAFYGLGLNSSI
VLHAIGFASGSNLYEKLYNQAVGMLILACAGSLPGYWMAVFTIDTVGRKPLQVCGFLLLTVVFCILGFRLGSLSE
GAMLALYVVGQFLFNAGPNTTTFVVPGECFPTRYRATGHGLSAAMGKMGAVVAQVISIPLLRRGSDDACTGAACS
PQLDRLLQLFALCMLLGTLFSLLIPETKGLTLEELSGESRTSYNAGCNGSIDVDPSKARTWNPFRGGQPAGFFYP
RSHSATFTKGGGRSARAGMMASAGLAAGPGSVGVGGQQQQQQQRRRRLWSRSRKRRAGSDGSNEIALRSRSLRSD
GHDDESGGAAGTEQTMAPRQQHEQLPAWGAGWGRIDRGGPPPTTSNMQLQDVGMLLEPK*
Coding >Hirsu2|1513
ATGGCCGGCTCGCACGACGGCAGCCTTCCCCCGCGCATGGCCTTTCGCGGCCCTGACCGCACCTACGGCGGCAAC
CGGGCCTTCCACAACTTCTACAACGACTACTCGCACATCCCCGACGCCAACCTGCGCAGGCGCCTGGCCTTGTCC
GAGATCGACAAGGTGCCCTTTGGCCTCTATCACGTGCGCGCCGTCTTGGTCGCCGGCGTCGGCTTCCTCCTCGAT
TCCTACGACATATTTGCCATCAACGTCGTAGTCACCCTGCTCGGCCTGGTCTTCTGGAGTGGCGAGCACAACGAG
GATGGCTATGGCGGCCACGGCGGCGTCCTGCCCGACTCCACCAACCAGGCCCTCAAGGGGTCGACCAGCGCCGGC
ATCATCATTGGCATGGTCGTCTTTGGCTGGCTTGCCGACGCTCTCGGCCGCCGAAAGATGTACGGCATCGAGCTC
GCCATCATCATCTTCGGCACCTTCAGTTGCGCCCTCGCCTCGTCGAGCCCTGCCATCAGCTCCTCTGCCATCTTG
ATCTTTTGGCGCGTCCTGATGGGCATCGGCATAGGCGGCGACTATCCCCTTTCCTGCGTCATCACCTCCGAATTC
GCGCCGACGCGCTGGCGAGGGGCCATGGTCGCCGCCGTCTTCTCCATGCAGGGCCTCGGCCTGGTCCTGTCGGCC
CTCGTGGCGCTCATCACCACCGTCGCCTTCAAGGACTCCTTCCTCCACGTCAAGGACGAGACGCAGTGCGATGCC
GCGTGCCGGGCGGCGGCCGATCGGTCCTGGCGCATCATCGTCGGCGTCGGCGCCATCCCCGCCTGCCTGGCCCTC
TACTACCGCATCACCATCCCCGAGACGCCGCGCTACACCTTCGACGTGCGGCATGACGTGGAGAAGGCCGGGGCC
GACATCCGCGCCTACGTCCAGAGCAAGTCCAGCGGCGAGTACGAGGGCCACCGCGGCGCGAGGTCGCGCATCTCC
GAGACGCTGCTCAACGTCCCTCGAGCGTCGTGGTCGGACCTGGTGGCCTACTTTGCCCGGTGGAAGAACCTGCGC
GTCCTCGTCGGCACCACGGCCTCGTGGTTCCTGCTGGACCTGGCCTTTTACGGCCTCGGGCTCAACAGCAGCATC
GTGCTGCACGCCATCGGCTTCGCCAGCGGCAGCAACCTGTACGAGAAGCTGTACAACCAGGCCGTCGGCATGCTC
ATCCTGGCGTGCGCCGGCTCGCTGCCCGGCTACTGGATGGCCGTCTTCACCATCGACACGGTCGGGCGGAAGCCG
CTGCAGGTCTGCGGCTTCCTCCTGCTCACCGTCGTCTTCTGCATCCTCGGCTTCCGGCTGGGCAGCCTGAGCGAG
GGCGCCATGCTGGCGCTGTACGTGGTCGGCCAGTTCCTCTTCAACGCCGGGCCCAACACGACGACGTTTGTGGTG
CCGGGCGAGTGCTTCCCGACGCGCTACCGCGCCACGGGCCACGGCCTGTCGGCGGCCATGGGAAAGATGGGCGCC
GTGGTGGCCCAGGTCATCAGCATCCCGCTGCTGAGGCGCGGGTCGGACGACGCCTGCACCGGCGCCGCGTGCTCG
CCGCAGCTGGACCGCCTGCTGCAGCTGTTCGCGCTCTGCATGCTCCTCGGCACCCTGTTCTCGCTGCTGATCCCG
GAGACCAAGGGCCTGACGCTGGAGGAGCTGTCGGGCGAGTCGAGGACGAGCTACAACGCCGGCTGCAACGGCAGC
ATCGACGTGGACCCGTCCAAGGCCCGGACCTGGAACCCGTTCCGGGGCGGGCAGCCCGCCGGCTTCTTCTACCCG
CGATCGCACTCGGCCACCTTCACCAAGGGCGGCGGGCGGTCGGCGCGGGCGGGCATGATGGCGTCGGCGGGGCTG
GCGGCGGGGCCCGGCAGCGTCGGCGTCGGCGGGCAGCAGCAGCAGCAGCAGCAGCGCCGACGGCGGCTCTGGTCG
CGGAGCAGGAAGCGGCGGGCCGGCAGCGACGGATCCAACGAGATCGCGCTGAGGAGCCGCAGCCTGCGATCGGAC
GGACACGACGACGAATCGGGCGGCGCGGCGGGGACGGAGCAGACGATGGCGCCGCGGCAGCAACACGAACAGCTT
CCGGCGTGGGGAGCGGGCTGGGGCCGGATCGACCGCGGCGGACCGCCGCCGACGACGAGCAACATGCAGCTGCAG
GACGTGGGCATGCTGCTGGAGCCCAAGTAG
Transcript >Hirsu2|1513
ATGGCCGGCTCGCACGACGGCAGCCTTCCCCCGCGCATGGCCTTTCGCGGCCCTGACCGCACCTACGGCGGCAAC
CGGGCCTTCCACAACTTCTACAACGACTACTCGCACATCCCCGACGCCAACCTGCGCAGGCGCCTGGCCTTGTCC
GAGATCGACAAGGTGCCCTTTGGCCTCTATCACGTGCGCGCCGTCTTGGTCGCCGGCGTCGGCTTCCTCCTCGAT
TCCTACGACATATTTGCCATCAACGTCGTAGTCACCCTGCTCGGCCTGGTCTTCTGGAGTGGCGAGCACAACGAG
GATGGCTATGGCGGCCACGGCGGCGTCCTGCCCGACTCCACCAACCAGGCCCTCAAGGGGTCGACCAGCGCCGGC
ATCATCATTGGCATGGTCGTCTTTGGCTGGCTTGCCGACGCTCTCGGCCGCCGAAAGATGTACGGCATCGAGCTC
GCCATCATCATCTTCGGCACCTTCAGTTGCGCCCTCGCCTCGTCGAGCCCTGCCATCAGCTCCTCTGCCATCTTG
ATCTTTTGGCGCGTCCTGATGGGCATCGGCATAGGCGGCGACTATCCCCTTTCCTGCGTCATCACCTCCGAATTC
GCGCCGACGCGCTGGCGAGGGGCCATGGTCGCCGCCGTCTTCTCCATGCAGGGCCTCGGCCTGGTCCTGTCGGCC
CTCGTGGCGCTCATCACCACCGTCGCCTTCAAGGACTCCTTCCTCCACGTCAAGGACGAGACGCAGTGCGATGCC
GCGTGCCGGGCGGCGGCCGATCGGTCCTGGCGCATCATCGTCGGCGTCGGCGCCATCCCCGCCTGCCTGGCCCTC
TACTACCGCATCACCATCCCCGAGACGCCGCGCTACACCTTCGACGTGCGGCATGACGTGGAGAAGGCCGGGGCC
GACATCCGCGCCTACGTCCAGAGCAAGTCCAGCGGCGAGTACGAGGGCCACCGCGGCGCGAGGTCGCGCATCTCC
GAGACGCTGCTCAACGTCCCTCGAGCGTCGTGGTCGGACCTGGTGGCCTACTTTGCCCGGTGGAAGAACCTGCGC
GTCCTCGTCGGCACCACGGCCTCGTGGTTCCTGCTGGACCTGGCCTTTTACGGCCTCGGGCTCAACAGCAGCATC
GTGCTGCACGCCATCGGCTTCGCCAGCGGCAGCAACCTGTACGAGAAGCTGTACAACCAGGCCGTCGGCATGCTC
ATCCTGGCGTGCGCCGGCTCGCTGCCCGGCTACTGGATGGCCGTCTTCACCATCGACACGGTCGGGCGGAAGCCG
CTGCAGGTCTGCGGCTTCCTCCTGCTCACCGTCGTCTTCTGCATCCTCGGCTTCCGGCTGGGCAGCCTGAGCGAG
GGCGCCATGCTGGCGCTGTACGTGGTCGGCCAGTTCCTCTTCAACGCCGGGCCCAACACGACGACGTTTGTGGTG
CCGGGCGAGTGCTTCCCGACGCGCTACCGCGCCACGGGCCACGGCCTGTCGGCGGCCATGGGAAAGATGGGCGCC
GTGGTGGCCCAGGTCATCAGCATCCCGCTGCTGAGGCGCGGGTCGGACGACGCCTGCACCGGCGCCGCGTGCTCG
CCGCAGCTGGACCGCCTGCTGCAGCTGTTCGCGCTCTGCATGCTCCTCGGCACCCTGTTCTCGCTGCTGATCCCG
GAGACCAAGGGCCTGACGCTGGAGGAGCTGTCGGGCGAGTCGAGGACGAGCTACAACGCCGGCTGCAACGGCAGC
ATCGACGTGGACCCGTCCAAGGCCCGGACCTGGAACCCGTTCCGGGGCGGGCAGCCCGCCGGCTTCTTCTACCCG
CGATCGCACTCGGCCACCTTCACCAAGGGCGGCGGGCGGTCGGCGCGGGCGGGCATGATGGCGTCGGCGGGGCTG
GCGGCGGGGCCCGGCAGCGTCGGCGTCGGCGGGCAGCAGCAGCAGCAGCAGCAGCGCCGACGGCGGCTCTGGTCG
CGGAGCAGGAAGCGGCGGGCCGGCAGCGACGGATCCAACGAGATCGCGCTGAGGAGCCGCAGCCTGCGATCGGAC
GGACACGACGACGAATCGGGCGGCGCGGCGGGGACGGAGCAGACGATGGCGCCGCGGCAGCAACACGAACAGCTT
CCGGCGTGGGGAGCGGGCTGGGGCCGGATCGACCGCGGCGGACCGCCGCCGACGACGAGCAACATGCAGCTGCAG
GACGTGGGCATGCTGCTGGAGCCCAAGTAG
Gene >Hirsu2|1513
ATGGCCGGCTCGCACGACGGCAGCCTTCCCCCGCGCATGGCCTTTCGCGGCCCTGACCGCACCTACGGCGGCAAC
CGGGCCTTCCACAACTTCTACAACGACTACTCGCACATCCCCGACGCCAACCTGCGCAGGCGCCTGGCCTTGTCC
GAGATCGACAAGGTGCCCTTTGGCCTCTATCGTGCGTCTCGCGCCCTCCCCGTTTCTGGCAGCTTCGTCTGTCTC
CCTGGTCTGCGCCCGTGCAACTGACAGCGGCCCCAGACGTGCGCGCCGTCTTGGTCGCCGGCGTCGGCTTCCTCC
TCGATTCCTACGACATATTTGCCATCAACGTCGTAGTCACCCTGCTCGGCCTGGTCTTCTGGAGTGGCGAGCACA
ACGAGGATGGCTATGGCGGCCACGGCGGCGTCCTGCCCGACTCCACCAACCAGGCCCTCAAGGGGTCGACCAGCG
CCGGCATCATCATTGGCATGGTCGTCTTTGGCTGGCTTGCCGAGTAAGCCTTGTTGACGCACGCCGCCTACCTGC
CCGCCCGCTGACGTGCCCTTGCAGCGCTCTCGGCCGCCGAAAGATGTACGGCATCGAGCTCGCCATCATCATCTT
CGGCACCTTCAGTTGCGCCCTCGCCTCGTCGAGCCCTGCCATCAGCTCCTCTGCCATCTTGATCTTTTGGCGCGT
CCTGATGGTGAGCCAGACCTGACCCTCGCCCGGCCGAGATGGAGAGAAGGGGGGGAGATTGACGGCGACTAGGGC
ATCGGCATAGGCGGCGACTATCCCCTTTCCTGCGTCATCACCTCCGAGTAAGCAAGCCTTGCGACGGCAAGCCGT
CCTCCTCCTCCTCCGCCGCTGACCGGGAGCTCTAGATTCGCGCCGACGCGCTGGCGAGGGGCCATGGTCGCCGCC
GTCTTCTCCATGCAGGGCCTCGGCCTGGTCCTGTCGGCCCTCGTGGCGCTCATCACCACCGTCGCCTTCAAGGAC
TCCTTCCTCCACGTCAAGGACGAGACGCAGTGCGATGCCGCGTGCCGGGCGGCGGCCGATCGGTCCTGGCGCATC
ATCGTCGGCGTCGGCGCCATCCCCGCCTGCCTGGCCCTCTACTACCGCATCACCATCCCCGAGACGCCGCGCTAC
ACCTTCGACGTGCGGCATGACGTGGAGAAGGCCGGGGCCGACATCCGCGCCTACGTCCAGAGCAAGTCCAGCGGC
GAGTACGAGGGCCACCGCGGCGCGAGGTCGCGCATCTCCGAGACGCTGCTCAACGTCCCTCGAGCGTCGTGGTCG
GACCTGGTGGCCTACTTTGCCCGGTGGAAGAACCTGCGCGTCCTCGTCGGCACCACGGCCTCGTGGTTCCTGCTG
GTACGTTGCCGTCGGGTCCGGCCCCGCCCCCTCGGTCGCTGACTTGCCCGCGCAGGACCTGGCCTTTTACGGCCT
CGGGCTCAACAGCAGCATCGTGCTGCACGCCATCGGCTTCGCCAGCGGCAGCAACCTGTACGAGAAGCTGTACAA
CCAGGCCGTCGGCATGCTCATCCTGGCGTGCGCCGGCTCGCTGCCCGGCTACTGGATGGCCGTCTTCACCATCGA
CACGGTCGGGCGGAAGCCGCTGCAGGTCTGCGGCTTCCTCCTGCTCACCGTCGTCTTCTGCATCCTCGGCTTCCG
GCTGGGCAGCCTGAGCGAGGGCGCCATGCTGGCGCTGTACGTGGTCGGCCAGTTCCTCTTCAACGCCGGGCCCAA
CACGACGACGTTTGTGGTGCCGGGCGAGTGCTTCCCGACGCGCTACCGCGCCACGGGCCACGGCCTGTCGGCGGC
CATGGGAAAGATGGGCGCCGTGGTGGCCCAGGTCATCAGCATCCCGCTGCTGAGGCGCGGGTCGGACGACGCCTG
CACCGGCGCCGCGTGCTCGCCGCAGCTGGACCGCCTGCTGCAGCTGTTCGCGCTCTGCATGCTCCTCGGCACCCT
GTTCTCGCTGCTGATCCCGGAGACCAAGGGCCTGACGCTGGAGGAGCTGTCGGGCGAGTCGAGGACGAGCTACAA
CGCCGGCTGCAACGGCAGCATCGACGTGGACCCGTCCAAGGCCCGGACCTGGAACCCGTTCCGGGGCGGGCAGCC
CGCCGGCTTCTTCTACCCGCGATCGCACTCGGCCACCTTCACCAAGGGCGGCGGGCGGTCGGCGCGGGCGGGCAT
GATGGCGTCGGCGGGGCTGGCGGCGGGGCCCGGCAGCGTCGGCGTCGGCGGGCAGCAGCAGCAGCAGCAGCAGCG
CCGACGGCGGCTCTGGTCGCGGAGCAGGAAGCGGCGGGCCGGCAGCGACGGATCCAACGAGATCGCGCTGAGGAG
CCGCAGCCTGCGATCGGACGGACACGACGACGAATCGGGCGGCGCGGCGGGGACGGAGCAGACGATGGCGCCGCG
GCAGCAACACGAACAGCTTCCGGCGTGGGGAGCGGGCTGGGGCCGGATCGACCGCGGCGGACCGCCGCCGACGAC
GAGCAACATGCAGCTGCAGGACGTGGGCATGCTGCTGGAGCCCAAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail