Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1512
Gene name
LocationContig_1333:4636..5527
Strand-
Gene length (bp)891
Transcript length (bp)891
Coding sequence length (bp)891
Protein length (aa) 297

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01467 CTP_transf_like Cytidylyltransferase-like 2.0E-19 57 251

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06178|NMA1_YEAST Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMA1 PE=1 SV=1 35 278 3.0E-61
sp|P53204|NMA2_YEAST Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMA2 PE=1 SV=1 35 276 1.0E-58
sp|Q9UT53|NMAH_SCHPO Nicotinamide/nicotinic acid mononucleotide adenylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC806.06c PE=1 SV=2 35 281 5.0E-58
sp|Q0VD50|NMNA1_BOVIN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Bos taurus GN=NMNAT1 PE=2 SV=1 46 276 1.0E-29
sp|F4K687|NMNAT_ARATH Nicotinamide/nicotinic acid mononucleotide adenylyltransferase OS=Arabidopsis thaliana GN=NMNAT PE=2 SV=1 37 278 2.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06178|NMA1_YEAST Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMA1 PE=1 SV=1 35 278 3.0E-61
sp|P53204|NMA2_YEAST Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMA2 PE=1 SV=1 35 276 1.0E-58
sp|Q9UT53|NMAH_SCHPO Nicotinamide/nicotinic acid mononucleotide adenylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC806.06c PE=1 SV=2 35 281 5.0E-58
sp|Q0VD50|NMNA1_BOVIN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Bos taurus GN=NMNAT1 PE=2 SV=1 46 276 1.0E-29
sp|F4K687|NMNAT_ARATH Nicotinamide/nicotinic acid mononucleotide adenylyltransferase OS=Arabidopsis thaliana GN=NMNAT PE=2 SV=1 37 278 2.0E-29
sp|Q99JR6|NMNA3_MOUSE Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3 OS=Mus musculus GN=Nmnat3 PE=1 SV=1 50 280 5.0E-28
sp|Q9HAN9|NMNA1_HUMAN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Homo sapiens GN=NMNAT1 PE=1 SV=1 46 280 1.0E-27
sp|Q0DWH7|NMNAT_ORYSJ Nicotinamide/nicotinic acid mononucleotide adenylyltransferase OS=Oryza sativa subsp. japonica GN=Os02g0814900 PE=3 SV=2 55 283 3.0E-27
sp|Q96T66|NMNA3_HUMAN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3 OS=Homo sapiens GN=NMNAT3 PE=1 SV=2 50 276 4.0E-27
sp|Q9EPA7|NMNA1_MOUSE Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Mus musculus GN=Nmnat1 PE=1 SV=2 49 280 5.0E-25
sp|P91851|NMNA2_CAEEL Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Caenorhabditis elegans GN=nmat-2 PE=3 SV=1 56 277 2.0E-21
sp|Q6PC93|NMNA2_DANRE Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Danio rerio GN=nmnat2 PE=2 SV=1 46 166 2.0E-18
sp|Q9BZQ4|NMNA2_HUMAN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Homo sapiens GN=NMNAT2 PE=1 SV=1 46 166 3.0E-18
sp|Q0HA29|NMNA2_RAT Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Rattus norvegicus GN=Nmnat2 PE=2 SV=1 46 166 3.0E-18
sp|Q0VC59|NMNA2_BOVIN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Bos taurus GN=NMNAT2 PE=2 SV=1 46 166 3.0E-18
sp|Q8BNJ3|NMNA2_MOUSE Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Mus musculus GN=Nmnat2 PE=2 SV=1 46 166 3.0E-18
sp|Q5RBL5|NMNA2_PONAB Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Pongo abelii GN=NMNAT2 PE=2 SV=1 46 166 4.0E-18
sp|A4IH61|NMNA2_XENTR Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Xenopus tropicalis GN=nmnat2 PE=2 SV=1 46 166 1.0E-17
sp|Q9BZQ4|NMNA2_HUMAN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Homo sapiens GN=NMNAT2 PE=1 SV=1 173 279 7.0E-08
sp|Q0VC59|NMNA2_BOVIN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Bos taurus GN=NMNAT2 PE=2 SV=1 173 279 7.0E-08
sp|Q8BNJ3|NMNA2_MOUSE Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Mus musculus GN=Nmnat2 PE=2 SV=1 173 279 7.0E-08
sp|Q5RBL5|NMNA2_PONAB Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Pongo abelii GN=NMNAT2 PE=2 SV=1 173 279 7.0E-08
sp|Q0HA29|NMNA2_RAT Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Rattus norvegicus GN=Nmnat2 PE=2 SV=1 173 279 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0003824 catalytic activity Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1512
MADSSPPLADSSPPPSPPGPRQPPPALAGPLSAPYAFPRHRLKRRLTQANKTPLVLVACGSFSPVTVLHLQMFEM
TGRYVRDTDFDVVGSYLSPVSDAYNKPSLARARDRVAMCTLAVEADDANASIMVDPWETLRCDDAGRPVYTRTAD
TLRHFDYEINHVLGGIQAADGSRLDARIALLIGADVAMTMSDPNVWDPADIDVILGTYGAFIVERPAQTDIRKAL
RPLERYHKIWVVSSFYNDVSSTKIRAQLRNSEMVLDLPKPVFDYIRTHALYRDAGPNDQQDKKQHQGAAAQ*
Coding >Hirsu2|1512
ATGGCCGACTCGTCGCCGCCGCTGGCCGACTCGTCGCCGCCGCCCTCGCCGCCCGGGCCCCGCCAACCCCCGCCC
GCCCTGGCCGGGCCCTTGTCCGCTCCCTACGCCTTCCCGCGCCACAGGCTGAAGCGCCGGCTGACGCAGGCCAAC
AAGACGCCTCTCGTCCTCGTCGCCTGCGGCAGCTTCTCCCCCGTCACCGTCCTGCACCTGCAGATGTTCGAGATG
ACGGGCCGCTACGTCCGCGACACCGACTTCGACGTCGTCGGCAGCTACCTGAGCCCCGTCAGCGACGCCTACAAC
AAGCCCTCGCTCGCCCGCGCCCGTGACCGCGTCGCCATGTGCACCCTCGCCGTCGAGGCCGACGACGCCAACGCC
AGCATCATGGTCGACCCCTGGGAAACGCTGCGCTGCGACGACGCCGGCCGGCCCGTCTATACCCGCACCGCCGAC
ACCCTGCGCCACTTCGACTACGAGATCAACCACGTGCTCGGCGGCATCCAGGCCGCCGACGGCTCCCGCCTCGAC
GCCCGCATCGCCCTGCTCATCGGCGCCGACGTCGCCATGACCATGAGCGACCCCAACGTCTGGGACCCGGCCGAC
ATCGACGTCATCCTCGGCACCTACGGCGCCTTCATCGTCGAGCGCCCCGCCCAGACCGACATCCGCAAGGCGCTC
CGGCCCCTCGAGCGCTATCACAAGATCTGGGTCGTGAGCTCCTTCTACAACGACGTCAGCTCCACCAAGATCCGA
GCCCAGCTGCGCAACAGCGAAATGGTCCTCGACCTCCCCAAGCCCGTCTTCGACTACATCAGGACGCACGCCCTC
TACCGGGACGCCGGCCCCAACGACCAGCAAGACAAAAAACAGCATCAAGGCGCCGCCGCACAATGA
Transcript >Hirsu2|1512
ATGGCCGACTCGTCGCCGCCGCTGGCCGACTCGTCGCCGCCGCCCTCGCCGCCCGGGCCCCGCCAACCCCCGCCC
GCCCTGGCCGGGCCCTTGTCCGCTCCCTACGCCTTCCCGCGCCACAGGCTGAAGCGCCGGCTGACGCAGGCCAAC
AAGACGCCTCTCGTCCTCGTCGCCTGCGGCAGCTTCTCCCCCGTCACCGTCCTGCACCTGCAGATGTTCGAGATG
ACGGGCCGCTACGTCCGCGACACCGACTTCGACGTCGTCGGCAGCTACCTGAGCCCCGTCAGCGACGCCTACAAC
AAGCCCTCGCTCGCCCGCGCCCGTGACCGCGTCGCCATGTGCACCCTCGCCGTCGAGGCCGACGACGCCAACGCC
AGCATCATGGTCGACCCCTGGGAAACGCTGCGCTGCGACGACGCCGGCCGGCCCGTCTATACCCGCACCGCCGAC
ACCCTGCGCCACTTCGACTACGAGATCAACCACGTGCTCGGCGGCATCCAGGCCGCCGACGGCTCCCGCCTCGAC
GCCCGCATCGCCCTGCTCATCGGCGCCGACGTCGCCATGACCATGAGCGACCCCAACGTCTGGGACCCGGCCGAC
ATCGACGTCATCCTCGGCACCTACGGCGCCTTCATCGTCGAGCGCCCCGCCCAGACCGACATCCGCAAGGCGCTC
CGGCCCCTCGAGCGCTATCACAAGATCTGGGTCGTGAGCTCCTTCTACAACGACGTCAGCTCCACCAAGATCCGA
GCCCAGCTGCGCAACAGCGAAATGGTCCTCGACCTCCCCAAGCCCGTCTTCGACTACATCAGGACGCACGCCCTC
TACCGGGACGCCGGCCCCAACGACCAGCAAGACAAAAAACAGCATCAAGGCGCCGCCGCACAATGA
Gene >Hirsu2|1512
ATGGCCGACTCGTCGCCGCCGCTGGCCGACTCGTCGCCGCCGCCCTCGCCGCCCGGGCCCCGCCAACCCCCGCCC
GCCCTGGCCGGGCCCTTGTCCGCTCCCTACGCCTTCCCGCGCCACAGGCTGAAGCGCCGGCTGACGCAGGCCAAC
AAGACGCCTCTCGTCCTCGTCGCCTGCGGCAGCTTCTCCCCCGTCACCGTCCTGCACCTGCAGATGTTCGAGATG
ACGGGCCGCTACGTCCGCGACACCGACTTCGACGTCGTCGGCAGCTACCTGAGCCCCGTCAGCGACGCCTACAAC
AAGCCCTCGCTCGCCCGCGCCCGTGACCGCGTCGCCATGTGCACCCTCGCCGTCGAGGCCGACGACGCCAACGCC
AGCATCATGGTCGACCCCTGGGAAACGCTGCGCTGCGACGACGCCGGCCGGCCCGTCTATACCCGCACCGCCGAC
ACCCTGCGCCACTTCGACTACGAGATCAACCACGTGCTCGGCGGCATCCAGGCCGCCGACGGCTCCCGCCTCGAC
GCCCGCATCGCCCTGCTCATCGGCGCCGACGTCGCCATGACCATGAGCGACCCCAACGTCTGGGACCCGGCCGAC
ATCGACGTCATCCTCGGCACCTACGGCGCCTTCATCGTCGAGCGCCCCGCCCAGACCGACATCCGCAAGGCGCTC
CGGCCCCTCGAGCGCTATCACAAGATCTGGGTCGTGAGCTCCTTCTACAACGACGTCAGCTCCACCAAGATCCGA
GCCCAGCTGCGCAACAGCGAAATGGTCCTCGACCTCCCCAAGCCCGTCTTCGACTACATCAGGACGCACGCCCTC
TACCGGGACGCCGGCCCCAACGACCAGCAAGACAAAAAACAGCATCAAGGCGCCGCCGCACAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail