Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|151
Gene name
LocationContig_1024:1367..6168
Strand-
Gene length (bp)4801
Transcript length (bp)4344
Coding sequence length (bp)4344
Protein length (aa) 1448

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02364 Glucan_synthase 1,3-beta-glucan synthase component 0.0E+00 857 1432
PF14288 FKS1_dom1 1,3-beta-glucan synthase subunit FKS1, domain-1 1.1E-42 344 451

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2QLK4|FKS1_ASPNC 1,3-beta-glucan synthase component FKS1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fksA PE=3 SV=1 1 1427 0.0E+00
sp|P38631|FKS1_YEAST 1,3-beta-glucan synthase component FKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKS1 PE=1 SV=2 44 1427 0.0E+00
sp|P40989|FKS2_YEAST 1,3-beta-glucan synthase component GSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSC2 PE=1 SV=2 9 1427 0.0E+00
sp|O74475|BGS4_SCHPO 1,3-beta-glucan synthase component bgs4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgs4 PE=1 SV=1 6 1427 0.0E+00
sp|O93927|FKS1_CRYNH 1,3-beta-glucan synthase component FKS1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=FKS1 PE=3 SV=3 157 1433 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2QLK4|FKS1_ASPNC 1,3-beta-glucan synthase component FKS1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fksA PE=3 SV=1 1 1427 0.0E+00
sp|P38631|FKS1_YEAST 1,3-beta-glucan synthase component FKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKS1 PE=1 SV=2 44 1427 0.0E+00
sp|P40989|FKS2_YEAST 1,3-beta-glucan synthase component GSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSC2 PE=1 SV=2 9 1427 0.0E+00
sp|O74475|BGS4_SCHPO 1,3-beta-glucan synthase component bgs4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgs4 PE=1 SV=1 6 1427 0.0E+00
sp|O93927|FKS1_CRYNH 1,3-beta-glucan synthase component FKS1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=FKS1 PE=3 SV=3 157 1433 0.0E+00
sp|O13967|BGS2_SCHPO 1,3-beta-glucan synthase component bgs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgs2 PE=2 SV=2 174 1427 0.0E+00
sp|Q04952|FKS3_YEAST 1,3-beta-glucan synthase component FKS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKS3 PE=1 SV=1 179 1427 0.0E+00
sp|Q10287|BGS1_SCHPO 1,3-beta-glucan synthase component bgs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgs1 PE=1 SV=1 135 1427 0.0E+00
sp|Q9P377|BGS3_SCHPO 1,3-beta-glucan synthase component bgs3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgs3 PE=1 SV=1 195 1427 0.0E+00
sp|Q9LXT9|CALS3_ARATH Callose synthase 3 OS=Arabidopsis thaliana GN=CALS3 PE=2 SV=3 859 1357 4.0E-85
sp|Q9SHJ3|CALS7_ARATH Callose synthase 7 OS=Arabidopsis thaliana GN=CALS7 PE=3 SV=3 859 1357 3.0E-82
sp|Q9SFU6|CALS9_ARATH Callose synthase 9 OS=Arabidopsis thaliana GN=CALS9 PE=2 SV=2 859 1374 2.0E-81
sp|Q3B724|CALS5_ARATH Callose synthase 5 OS=Arabidopsis thaliana GN=CALS5 PE=1 SV=1 859 1357 1.0E-80
sp|Q9LYS6|CALS6_ARATH Putative callose synthase 6 OS=Arabidopsis thaliana GN=CALS6 PE=3 SV=2 859 1441 5.0E-80
sp|Q9AUE0|CALS1_ARATH Callose synthase 1 OS=Arabidopsis thaliana GN=CALS1 PE=1 SV=2 859 1385 1.0E-79
sp|Q9SJM0|CALSA_ARATH Callose synthase 10 OS=Arabidopsis thaliana GN=CALS10 PE=2 SV=5 859 1357 8.0E-79
sp|Q9LTG5|CALS4_ARATH Callose synthase 4 OS=Arabidopsis thaliana GN=CALS4 PE=3 SV=2 859 1357 2.0E-77
sp|Q9ZT82|CALSC_ARATH Callose synthase 12 OS=Arabidopsis thaliana GN=CALS12 PE=2 SV=1 859 1357 2.0E-77
sp|Q9SL03|CALS2_ARATH Callose synthase 2 OS=Arabidopsis thaliana GN=CALS2 PE=2 SV=3 859 1357 4.0E-76
sp|Q9S9U0|CALSB_ARATH Callose synthase 11 OS=Arabidopsis thaliana GN=CALS11 PE=2 SV=1 859 1440 9.0E-74
sp|Q9LUD7|CALS8_ARATH Putative callose synthase 8 OS=Arabidopsis thaliana GN=CALS8 PE=2 SV=2 859 1357 4.0E-72
sp|Q3B724|CALS5_ARATH Callose synthase 5 OS=Arabidopsis thaliana GN=CALS5 PE=1 SV=1 213 751 3.0E-15
sp|Q9LYS6|CALS6_ARATH Putative callose synthase 6 OS=Arabidopsis thaliana GN=CALS6 PE=3 SV=2 348 506 1.0E-14
sp|Q9SJM0|CALSA_ARATH Callose synthase 10 OS=Arabidopsis thaliana GN=CALS10 PE=2 SV=5 190 506 1.0E-14
sp|Q9SFU6|CALS9_ARATH Callose synthase 9 OS=Arabidopsis thaliana GN=CALS9 PE=2 SV=2 205 762 2.0E-14
sp|Q9LXT9|CALS3_ARATH Callose synthase 3 OS=Arabidopsis thaliana GN=CALS3 PE=2 SV=3 208 499 4.0E-12
sp|Q9LTG5|CALS4_ARATH Callose synthase 4 OS=Arabidopsis thaliana GN=CALS4 PE=3 SV=2 198 630 9.0E-12
sp|Q9ZT82|CALSC_ARATH Callose synthase 12 OS=Arabidopsis thaliana GN=CALS12 PE=2 SV=1 187 506 2.0E-11
sp|Q9LUD7|CALS8_ARATH Putative callose synthase 8 OS=Arabidopsis thaliana GN=CALS8 PE=2 SV=2 213 447 1.0E-10
sp|Q9SL03|CALS2_ARATH Callose synthase 2 OS=Arabidopsis thaliana GN=CALS2 PE=2 SV=3 212 503 2.0E-10
sp|Q9AUE0|CALS1_ARATH Callose synthase 1 OS=Arabidopsis thaliana GN=CALS1 PE=1 SV=2 187 503 3.0E-10
sp|Q9SHJ3|CALS7_ARATH Callose synthase 7 OS=Arabidopsis thaliana GN=CALS7 PE=3 SV=3 355 500 5.0E-09
sp|Q9S9U0|CALSB_ARATH Callose synthase 11 OS=Arabidopsis thaliana GN=CALS11 PE=2 SV=1 348 483 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0000148 1,3-beta-D-glucan synthase complex Yes
GO:0003843 1,3-beta-D-glucan synthase activity Yes
GO:0006075 (1->3)-beta-D-glucan biosynthetic process Yes
GO:0008194 UDP-glycosyltransferase activity No
GO:0006074 (1->3)-beta-D-glucan metabolic process No
GO:0000271 polysaccharide biosynthetic process No
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0033692 cellular polysaccharide biosynthetic process No
GO:0009058 biosynthetic process No
GO:0098796 membrane protein complex No
GO:0044464 cell part No
GO:1901576 organic substance biosynthetic process No
GO:0005976 polysaccharide metabolic process No
GO:0098797 plasma membrane protein complex No
GO:0034637 cellular carbohydrate biosynthetic process No
GO:0044425 membrane part No
GO:0051273 beta-glucan metabolic process No
GO:0044042 glucan metabolic process No
GO:0035251 UDP-glucosyltransferase activity No
GO:0051274 beta-glucan biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1902494 catalytic complex No
GO:0071704 organic substance metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0044459 plasma membrane part No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0046527 glucosyltransferase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0044262 cellular carbohydrate metabolic process No
GO:0009250 glucan biosynthetic process No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0016051 carbohydrate biosynthetic process No
GO:0032991 protein-containing complex No
GO:1990234 transferase complex No
GO:0044264 cellular polysaccharide metabolic process No
GO:0016758 transferase activity, transferring hexosyl groups No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0006073 cellular glucan metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 498 520 22
2 540 562 22
3 577 596 19
4 609 631 22
5 664 686 22
6 724 746 22
7 1344 1366 22
8 1399 1421 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|151
MSGYPGGHEHYEDGYTHQGGNTDSYYQDDQYYDNGYDARGGHGGNTGHGGNAGDGYYDESGYYNADPNNPYHQDG
GYYDGHDQYQDEYYNTHGGYYDQEYNNGYAGHGGRHGSEEDSETFSDFTMRSDMARAAEMDYYGRGDERHVSYGD
GQRGYRPPSSQISYGANRSSGASTPNYGMDYGNVLPAGQRSREPYPAWTSDAQIPLSKEEIEDIFMDLTAKFGFQ
RDSMRNMYDHLMTLLDSRASRMTPNQALLSLHADYIGGDNANYRKWYFAAHLDLDDAVGFANAKSKNLRRRAKNK
KKKQNAGDAATEDEALQDLEGDNSLEAAEYRWKTRMNRMSQHDRVRQIALYLLCWGEANQVRFMPECLCFIFKCA
DDYLNSPACQSLVEPVDEFTYLNNVITPLYQYCRDQGYEILNGVYVRRERDHKHIIGYDDCNQLFWYPEGIERLV
LQDKSKLVDVPPAERYLKLKDVDWKKCFFKTYKETRSWFHLLVNFNRIWIIHLTMFWFYTAHNAPTLIVGSKYEQ
QVNNQPEASKQFSVVAFGGGIAALIQILATLAEWAYVPRRWAGAQHLTKRLLFLLVIFILNVGPGVKVFMLPTDR
KSSSVDIDLIIGIVHFVIAIITFIFFAVMPLGGLFGSYLTKNSRRYVASQTFTASYPRLSGNDMAMSYGLWLTVF
GAKFGESYVYLTLSFRDVIRYLSIFHPRCKGDNLFGSVSDILCKNHPAILLGLMAFTDLIFFFLDTYLFYVLLNT
IFSIARSFYIGSSIWTPWRNIFSRLPKRIYSKVLATTDMEIKYKPKVLISQVWNAIVISMYREHLLAIDHVQKLL
YHQVPSEQEGKRTLRAPTFFVSQEDHSFKTEFFPSHSEAERRISFFAQSLSTPIPEPLPVDNMPTFTVMIPHYSE
KILLSLREIIREDEPYSRVTLLEYLKQLHPHEWDCFVKDTKILADETSQMNGDLEKSEKDAAKSKIDDLPFYCIG
FKSSAPEYTLRTRIWASLRSQTLYRTVSGFMNYSRAIKLLYRVENPEVVQMFGGNSDKLERELERMARRKFKIVV
SMQRYSKFKKEEMENAEFLLRAYPDLQIAYLDEEPPLAEGEEPRLYSALIDGHSELMENGMRRPKFRIQLSGNPV
LGDGKSDNQNHSLIFYRGEYIQLIDANQDNYLEECLKIRSVLAEFEEMKMENLSPYTPGVKNETPAPVAILGARE
YIFSENIGILGDVAAGKEQTFGTLFARTLAQIGGKLHYGHPDFLNGIFMTTRGGVSKAQKGLHLNEDIFAGMNAI
LRGGRIKHCEYYQCGKGRDLGFGSILNFTTKIGTGMGEQMLSREYYYLGTQLPLDRFLSFYYAHPGFHINNMFIM
LSVQLFMLTLLNFGAFRHETIACDYNRNKPLTDPLFPTGCANTEAMMDWVNRSILSIFFVFFLSFVPLIVQELTE
RGESCVIMDRFLPSVENPDHWL*
Coding >Hirsu2|151
ATGTCGGGGTATCCGGGTGGTCACGAACACTACGAAGATGGCTACACCCATCAAGGTGGCAACACAGATTCGTAC
TATCAGGATGATCAATACTACGACAATGGCTACGACGCCCGTGGCGGCCACGGCGGCAACACCGGCCACGGCGGC
AACGCCGGCGATGGCTACTACGACGAATCGGGCTACTACAACGCCGATCCCAACAACCCGTATCATCAAGATGGC
GGATATTATGACGGGCATGACCAGTATCAGGATGAGTACTACAACACCCATGGCGGCTACTATGACCAGGAGTAC
AACAACGGGTACGCCGGCCATGGTGGCCGTCACGGCTCTGAGGAGGATTCGGAGACTTTCAGCGACTTCACCATG
AGGTCCGACATGGCTCGCGCTGCTGAGATGGATTACTACGGGCGCGGTGATGAGAGACATGTCAGCTACGGTGAC
GGCCAGCGTGGGTACCGGCCGCCCTCGTCTCAGATCTCTTATGGCGCCAACCGCTCCTCTGGTGCTTCGACGCCG
AACTACGGCATGGACTACGGCAATGTTCTACCAGCTGGTCAACGCTCTCGAGAGCCGTACCCCGCCTGGACCTCC
GACGCCCAGATCCCCCTCTCCAAAGAGGAGATCGAAGACATCTTCATGGACTTGACGGCCAAATTCGGCTTCCAG
CGAGACAGCATGCGAAACATGTACGACCACTTGATGACTCTCCTGGACTCCCGAGCTTCTCGCATGACGCCAAAT
CAAGCATTGCTGTCTCTTCACGCCGATTACATCGGGGGCGACAATGCCAACTATCGCAAGTGGTACTTTGCCGCA
CATCTCGACTTGGATGATGCCGTGGGCTTCGCCAACGCCAAGAGCAAGAATTTGCGCCGCAGAGCCAAGAACAAG
AAGAAGAAACAGAACGCCGGAGATGCTGCTACCGAGGACGAAGCCCTTCAGGATCTCGAGGGTGACAATAGCTTG
GAAGCAGCTGAGTACCGCTGGAAGACCCGCATGAACCGCATGTCCCAGCACGACCGTGTGCGACAGATTGCGCTG
TACCTCCTTTGCTGGGGCGAGGCCAATCAAGTTCGTTTCATGCCAGAGTGTCTCTGCTTTATTTTCAAGTGTGCC
GATGATTATCTCAACTCCCCCGCCTGCCAATCCCTTGTTGAGCCCGTCGACGAATTCACGTACCTCAATAACGTC
ATCACTCCTCTCTACCAGTATTGTCGGGATCAAGGATACGAGATCCTCAACGGAGTCTACGTCCGTCGCGAACGC
GATCACAAGCACATCATTGGCTACGATGATTGCAATCAGCTTTTCTGGTACCCGGAAGGCATCGAGCGCCTCGTG
CTCCAGGACAAAAGCAAACTTGTCGACGTGCCGCCCGCTGAACGCTACCTCAAGCTGAAAGATGTGGACTGGAAA
AAATGCTTCTTCAAGACATACAAGGAGACGCGGTCATGGTTTCATCTTCTGGTTAATTTTAACCGCATTTGGATC
ATTCACCTGACCATGTTCTGGTTCTACACGGCACACAACGCGCCGACCCTGATTGTGGGTTCAAAATACGAGCAG
CAGGTCAACAACCAACCGGAGGCATCGAAGCAGTTTTCCGTCGTTGCCTTCGGCGGTGGCATCGCCGCTCTCATC
CAGATTCTCGCAACCTTGGCCGAGTGGGCGTATGTCCCTCGCCGCTGGGCCGGCGCCCAACATCTGACCAAGAGG
CTGCTCTTTCTTCTCGTTATCTTCATCCTCAATGTTGGCCCGGGAGTCAAGGTATTCATGCTACCTACCGACAGG
AAGTCCAGTTCTGTGGACATCGACCTGATCATCGGTATCGTGCATTTCGTGATTGCCATCATCACGTTTATCTTC
TTTGCCGTCATGCCTCTAGGTGGCTTGTTCGGCAGTTACCTCACGAAGAACTCGAGAAGATATGTTGCCAGCCAA
ACCTTCACTGCCAGCTACCCCAGGCTCTCCGGCAATGACATGGCTATGTCATATGGTCTGTGGCTGACAGTGTTT
GGTGCCAAGTTTGGAGAGTCATACGTCTACCTCACACTCTCTTTCCGTGACGTGATTCGTTATCTCTCCATCTTC
CACCCGCGGTGCAAAGGCGACAATCTCTTCGGCTCAGTCAGCGACATTCTCTGCAAGAACCACCCCGCCATACTA
CTTGGCTTGATGGCATTTACGGATTTAATCTTCTTCTTCCTCGACACCTACCTGTTCTACGTCCTCCTGAACACC
ATATTTTCGATTGCTCGGTCATTCTATATCGGTTCCTCAATATGGACGCCTTGGCGAAATATCTTTTCTCGCTTG
CCGAAACGGATCTACTCCAAGGTTTTGGCCACGACTGACATGGAGATCAAGTACAAACCCAAGGTCTTGATTTCG
CAGGTCTGGAACGCCATTGTCATTTCCATGTATCGCGAACATCTCCTGGCTATTGATCACGTCCAAAAGCTGCTT
TACCATCAGGTCCCGTCCGAGCAAGAGGGCAAACGCACGTTGCGAGCTCCTACGTTTTTCGTTTCCCAAGAGGAC
CATTCCTTCAAGACCGAGTTCTTCCCCAGCCATAGTGAGGCGGAGCGCCGAATCTCCTTCTTTGCTCAGTCGCTG
TCCACTCCGATCCCGGAACCGCTTCCGGTGGACAACATGCCTACCTTTACGGTCATGATTCCTCATTATAGCGAG
AAGATTCTTTTGTCCCTACGGGAAATAATTCGTGAAGACGAGCCGTACTCTCGAGTTACACTCCTTGAGTACCTC
AAACAGCTGCATCCTCACGAATGGGACTGCTTCGTCAAGGATACCAAGATCTTGGCCGATGAGACGTCGCAAATG
AATGGTGATCTCGAGAAAAGCGAGAAAGACGCAGCCAAGAGCAAGATTGACGATCTCCCGTTCTATTGCATCGGC
TTCAAATCATCAGCTCCGGAGTACACACTCCGAACCCGCATCTGGGCATCTCTCCGTTCGCAGACGCTTTATCGC
ACCGTTTCGGGCTTCATGAACTACAGTCGTGCGATCAAGCTTCTGTATCGCGTGGAGAACCCAGAGGTTGTTCAG
ATGTTCGGCGGTAACTCCGATAAGCTCGAACGGGAACTTGAGCGCATGGCCCGCCGCAAATTCAAGATAGTCGTC
TCCATGCAGCGCTACTCCAAGTTTAAGAAGGAAGAAATGGAGAATGCTGAATTCTTGCTCCGTGCCTATCCCGAC
CTCCAGATTGCCTATCTCGACGAAGAACCACCTTTGGCCGAAGGCGAGGAGCCTCGGCTCTACTCTGCTCTGATT
GACGGTCACTCGGAACTCATGGAGAATGGCATGCGACGGCCCAAATTCCGGATTCAGCTTTCCGGCAATCCCGTA
CTGGGTGATGGCAAGTCCGATAATCAAAATCACTCCCTCATTTTCTATCGCGGCGAATATATCCAGCTTATCGAC
GCCAATCAGGACAATTATCTAGAGGAGTGTCTCAAAATTCGAAGTGTGCTTGCGGAATTCGAAGAGATGAAAATG
GAGAACCTGTCACCATACACGCCAGGCGTCAAGAACGAAACCCCCGCACCGGTCGCCATTCTCGGAGCTCGCGAG
TACATCTTTTCAGAGAATATCGGAATTCTTGGCGACGTCGCTGCTGGCAAAGAGCAGACCTTCGGGACCCTCTTT
GCACGTACTCTGGCGCAAATTGGAGGCAAACTCCACTATGGGCATCCGGATTTTCTCAATGGCATCTTCATGACT
ACACGCGGTGGCGTGTCCAAAGCTCAGAAGGGTCTTCATCTAAACGAAGACATTTTCGCCGGAATGAACGCCATC
CTTCGCGGCGGTCGCATCAAGCACTGCGAATACTATCAGTGCGGCAAAGGTCGTGATCTGGGCTTTGGTTCGATT
CTCAATTTCACCACCAAGATTGGTACTGGCATGGGTGAACAAATGCTCTCCCGGGAGTACTACTACCTCGGTACT
CAACTTCCCCTCGACCGATTCTTGTCCTTTTACTACGCGCATCCCGGCTTCCATATCAACAACATGTTCATCATG
CTCTCTGTCCAGCTGTTCATGCTTACCCTGCTCAACTTCGGCGCTTTTCGCCACGAAACCATTGCCTGCGACTAC
AATCGAAACAAGCCGCTTACGGATCCCCTCTTCCCGACCGGTTGCGCTAATACTGAAGCTATGATGGACTGGGTC
AACCGCAGTATCTTATCCATCTTCTTCGTGTTCTTCCTGTCTTTCGTTCCCCTGATCGTCCAGGAGCTTACGGAA
CGGGGTGAGTCATGCGTCATCATGGATCGCTTTCTGCCGTCTGTCGAGAACCCGGATCACTGGTTATAA
Transcript >Hirsu2|151
ATGTCGGGGTATCCGGGTGGTCACGAACACTACGAAGATGGCTACACCCATCAAGGTGGCAACACAGATTCGTAC
TATCAGGATGATCAATACTACGACAATGGCTACGACGCCCGTGGCGGCCACGGCGGCAACACCGGCCACGGCGGC
AACGCCGGCGATGGCTACTACGACGAATCGGGCTACTACAACGCCGATCCCAACAACCCGTATCATCAAGATGGC
GGATATTATGACGGGCATGACCAGTATCAGGATGAGTACTACAACACCCATGGCGGCTACTATGACCAGGAGTAC
AACAACGGGTACGCCGGCCATGGTGGCCGTCACGGCTCTGAGGAGGATTCGGAGACTTTCAGCGACTTCACCATG
AGGTCCGACATGGCTCGCGCTGCTGAGATGGATTACTACGGGCGCGGTGATGAGAGACATGTCAGCTACGGTGAC
GGCCAGCGTGGGTACCGGCCGCCCTCGTCTCAGATCTCTTATGGCGCCAACCGCTCCTCTGGTGCTTCGACGCCG
AACTACGGCATGGACTACGGCAATGTTCTACCAGCTGGTCAACGCTCTCGAGAGCCGTACCCCGCCTGGACCTCC
GACGCCCAGATCCCCCTCTCCAAAGAGGAGATCGAAGACATCTTCATGGACTTGACGGCCAAATTCGGCTTCCAG
CGAGACAGCATGCGAAACATGTACGACCACTTGATGACTCTCCTGGACTCCCGAGCTTCTCGCATGACGCCAAAT
CAAGCATTGCTGTCTCTTCACGCCGATTACATCGGGGGCGACAATGCCAACTATCGCAAGTGGTACTTTGCCGCA
CATCTCGACTTGGATGATGCCGTGGGCTTCGCCAACGCCAAGAGCAAGAATTTGCGCCGCAGAGCCAAGAACAAG
AAGAAGAAACAGAACGCCGGAGATGCTGCTACCGAGGACGAAGCCCTTCAGGATCTCGAGGGTGACAATAGCTTG
GAAGCAGCTGAGTACCGCTGGAAGACCCGCATGAACCGCATGTCCCAGCACGACCGTGTGCGACAGATTGCGCTG
TACCTCCTTTGCTGGGGCGAGGCCAATCAAGTTCGTTTCATGCCAGAGTGTCTCTGCTTTATTTTCAAGTGTGCC
GATGATTATCTCAACTCCCCCGCCTGCCAATCCCTTGTTGAGCCCGTCGACGAATTCACGTACCTCAATAACGTC
ATCACTCCTCTCTACCAGTATTGTCGGGATCAAGGATACGAGATCCTCAACGGAGTCTACGTCCGTCGCGAACGC
GATCACAAGCACATCATTGGCTACGATGATTGCAATCAGCTTTTCTGGTACCCGGAAGGCATCGAGCGCCTCGTG
CTCCAGGACAAAAGCAAACTTGTCGACGTGCCGCCCGCTGAACGCTACCTCAAGCTGAAAGATGTGGACTGGAAA
AAATGCTTCTTCAAGACATACAAGGAGACGCGGTCATGGTTTCATCTTCTGGTTAATTTTAACCGCATTTGGATC
ATTCACCTGACCATGTTCTGGTTCTACACGGCACACAACGCGCCGACCCTGATTGTGGGTTCAAAATACGAGCAG
CAGGTCAACAACCAACCGGAGGCATCGAAGCAGTTTTCCGTCGTTGCCTTCGGCGGTGGCATCGCCGCTCTCATC
CAGATTCTCGCAACCTTGGCCGAGTGGGCGTATGTCCCTCGCCGCTGGGCCGGCGCCCAACATCTGACCAAGAGG
CTGCTCTTTCTTCTCGTTATCTTCATCCTCAATGTTGGCCCGGGAGTCAAGGTATTCATGCTACCTACCGACAGG
AAGTCCAGTTCTGTGGACATCGACCTGATCATCGGTATCGTGCATTTCGTGATTGCCATCATCACGTTTATCTTC
TTTGCCGTCATGCCTCTAGGTGGCTTGTTCGGCAGTTACCTCACGAAGAACTCGAGAAGATATGTTGCCAGCCAA
ACCTTCACTGCCAGCTACCCCAGGCTCTCCGGCAATGACATGGCTATGTCATATGGTCTGTGGCTGACAGTGTTT
GGTGCCAAGTTTGGAGAGTCATACGTCTACCTCACACTCTCTTTCCGTGACGTGATTCGTTATCTCTCCATCTTC
CACCCGCGGTGCAAAGGCGACAATCTCTTCGGCTCAGTCAGCGACATTCTCTGCAAGAACCACCCCGCCATACTA
CTTGGCTTGATGGCATTTACGGATTTAATCTTCTTCTTCCTCGACACCTACCTGTTCTACGTCCTCCTGAACACC
ATATTTTCGATTGCTCGGTCATTCTATATCGGTTCCTCAATATGGACGCCTTGGCGAAATATCTTTTCTCGCTTG
CCGAAACGGATCTACTCCAAGGTTTTGGCCACGACTGACATGGAGATCAAGTACAAACCCAAGGTCTTGATTTCG
CAGGTCTGGAACGCCATTGTCATTTCCATGTATCGCGAACATCTCCTGGCTATTGATCACGTCCAAAAGCTGCTT
TACCATCAGGTCCCGTCCGAGCAAGAGGGCAAACGCACGTTGCGAGCTCCTACGTTTTTCGTTTCCCAAGAGGAC
CATTCCTTCAAGACCGAGTTCTTCCCCAGCCATAGTGAGGCGGAGCGCCGAATCTCCTTCTTTGCTCAGTCGCTG
TCCACTCCGATCCCGGAACCGCTTCCGGTGGACAACATGCCTACCTTTACGGTCATGATTCCTCATTATAGCGAG
AAGATTCTTTTGTCCCTACGGGAAATAATTCGTGAAGACGAGCCGTACTCTCGAGTTACACTCCTTGAGTACCTC
AAACAGCTGCATCCTCACGAATGGGACTGCTTCGTCAAGGATACCAAGATCTTGGCCGATGAGACGTCGCAAATG
AATGGTGATCTCGAGAAAAGCGAGAAAGACGCAGCCAAGAGCAAGATTGACGATCTCCCGTTCTATTGCATCGGC
TTCAAATCATCAGCTCCGGAGTACACACTCCGAACCCGCATCTGGGCATCTCTCCGTTCGCAGACGCTTTATCGC
ACCGTTTCGGGCTTCATGAACTACAGTCGTGCGATCAAGCTTCTGTATCGCGTGGAGAACCCAGAGGTTGTTCAG
ATGTTCGGCGGTAACTCCGATAAGCTCGAACGGGAACTTGAGCGCATGGCCCGCCGCAAATTCAAGATAGTCGTC
TCCATGCAGCGCTACTCCAAGTTTAAGAAGGAAGAAATGGAGAATGCTGAATTCTTGCTCCGTGCCTATCCCGAC
CTCCAGATTGCCTATCTCGACGAAGAACCACCTTTGGCCGAAGGCGAGGAGCCTCGGCTCTACTCTGCTCTGATT
GACGGTCACTCGGAACTCATGGAGAATGGCATGCGACGGCCCAAATTCCGGATTCAGCTTTCCGGCAATCCCGTA
CTGGGTGATGGCAAGTCCGATAATCAAAATCACTCCCTCATTTTCTATCGCGGCGAATATATCCAGCTTATCGAC
GCCAATCAGGACAATTATCTAGAGGAGTGTCTCAAAATTCGAAGTGTGCTTGCGGAATTCGAAGAGATGAAAATG
GAGAACCTGTCACCATACACGCCAGGCGTCAAGAACGAAACCCCCGCACCGGTCGCCATTCTCGGAGCTCGCGAG
TACATCTTTTCAGAGAATATCGGAATTCTTGGCGACGTCGCTGCTGGCAAAGAGCAGACCTTCGGGACCCTCTTT
GCACGTACTCTGGCGCAAATTGGAGGCAAACTCCACTATGGGCATCCGGATTTTCTCAATGGCATCTTCATGACT
ACACGCGGTGGCGTGTCCAAAGCTCAGAAGGGTCTTCATCTAAACGAAGACATTTTCGCCGGAATGAACGCCATC
CTTCGCGGCGGTCGCATCAAGCACTGCGAATACTATCAGTGCGGCAAAGGTCGTGATCTGGGCTTTGGTTCGATT
CTCAATTTCACCACCAAGATTGGTACTGGCATGGGTGAACAAATGCTCTCCCGGGAGTACTACTACCTCGGTACT
CAACTTCCCCTCGACCGATTCTTGTCCTTTTACTACGCGCATCCCGGCTTCCATATCAACAACATGTTCATCATG
CTCTCTGTCCAGCTGTTCATGCTTACCCTGCTCAACTTCGGCGCTTTTCGCCACGAAACCATTGCCTGCGACTAC
AATCGAAACAAGCCGCTTACGGATCCCCTCTTCCCGACCGGTTGCGCTAATACTGAAGCTATGATGGACTGGGTC
AACCGCAGTATCTTATCCATCTTCTTCGTGTTCTTCCTGTCTTTCGTTCCCCTGATCGTCCAGGAGCTTACGGAA
CGGGGTGAGTCATGCGTCATCATGGATCGCTTTCTGCCGTCTGTCGAGAACCCGGATCACTGGTTATAA
Gene >Hirsu2|151
ATGTCGGGGTATCCGGGTGGTCACGAACACTACGAAGATGGCTACACCCATCAAGGTGGCAACACAGATTCGTAC
TATCAGGATGATCAATACTACGACAATGGCTACGACGCCCGTGGCGGCCACGGCGGCAACACCGGCCACGGCGGC
AACGCCGGCGATGGCTACTACGACGAATCGTTAGTGTACCCCATGATCCTGTTATGTGTACTCGCTGCTGACCCT
TTCTCCGTAGGGGCTACTACAACGCCGATCCCAACAACCCGTATCATCAAGATGGCGGATATTATGACGGGCATG
ACCAGTATCAGGATGAGTACTACAACACCCATGGCGGCTACTATGACCAGGAGTACAACAACGGGTACGCCGGCC
ATGGTGGCCGTCACGGCTCTGAGGAGGATTCGGAGACTTTCAGCGACTTCACCATGAGGTCCGACATGGCTCGCG
CTGCTGAGATGGATTACTACGGGCGCGGTGATGAGAGACATGTCAGCTACGGTGACGGCCAGCGTGGGTACCGGC
CGCCCTCGTCTCAGATCTCTTATGGCGCCAACCGCTCCTCTGGTGCTTCGACGCCGAACTACGGCATGGACTACG
GCAATGTTCTACCAGCTGGTCAACGCTCTCGAGAGCCGTACCCCGCCTGGACCTCCGACGCCCAGATCCCCCTCT
CCAAAGAGGAGATCGAAGACATCTTCATGGACTTGACGGCCAAATTCGGCTTCCAGCGAGACAGCATGCGAAACA
TGTACGACCACTTGATGACTCTCCTGGACTCCCGAGCTTCTCGCATGACGCCAAATCAAGCATTGCTGTCTCTTC
ACGCCGATTACATCGGGGGCGACAATGCCAACTATCGCAAGTGGTACTTTGCCGCACATCTCGACTTGGATGATG
CCGTGGGCTTCGCCAACGCCAAGAGCAAGAATTTGCGCCGCAGAGCCAAGAACAAGAAGAAGAAACAGAACGCCG
GAGATGCTGCTACCGAGGACGAAGCCCTTCAGGATCTCGAGGGTGACAATAGCTTGGAAGCAGCTGAGTACCGCT
GGAAGACCCGCATGAACCGCATGTCCCAGCACGACCGTGTGCGACAGATTGCGCTGTACCTCCTTTGCTGGGGCG
AGGCCAATCAAGTTCGTTTCATGCCAGAGTGTCTCTGCTTTATTTTCAAGTGTGCCGATGATTATCTCAACTCCC
CCGCCTGCCAATCCCTTGTTGAGCCCGTCGACGAATTCACGTACCTCAATAACGTCATCACTCCTCTCTACCAGT
ATTGTCGGGATCAAGGATACGAGATCCTCAACGGAGTCTACGTCCGTCGCGAACGCGATCACAAGCACATCATTG
GCTACGATGATTGCAATCAGCTTTTCTGGTACCCGGAAGGCATCGAGCGCCTCGTGCTCCAGGACAAAAGCAAAC
TTGTCGACGTGCCGCCCGCTGAACGCTACCTCAAGCTGAAAGATGTGGACTGGAAAAAATGCTTCTTCAAGACAT
ACAAGGAGACGCGGTCATGGTTTCATCTTCTGGTTAATTTTAACCGCATTTGGATCATTCACCTGACCATGTTCT
GGTTCTACACGGCACACAACGCGCCGACCCTGATTGTGGGTTCAAAATACGAGCAGCAGGTCAACAACCAACCGG
AGGCATCGAAGCAGTTTTCCGTCGTTGCCTTCGGCGGTGGCATCGCCGCTCTCATCCAGATTCTCGCAACCTTGG
CCGAGTGGGCGTATGTCCCTCGCCGCTGGGCCGGCGCCCAACATCTGACCAAGAGGCTGCTCTTTCTTCTCGTTA
TCTTCATCCTCAATGTTGGCCCGGGAGTCAAGGTATTCATGCTACCTACCGACAGGAAGTCCAGTTCTGTGGACA
TCGACCTGATCATCGGTATCGTGCATTTCGTGATTGCCATCATCACGTTTATCTTCTTTGCCGTCATGCCTCTAG
GTGGCTTGTTCGGCAGTTACCTCACGAAGAACTCGAGAAGATATGTTGCCAGCCAAACCTTCACTGCCAGCTACC
CCAGGCTCTCCGGCAATGACATGGCTATGTCATATGGTCTGTGGCTGACAGTGTTTGGTGCCAAGTTTGGAGAGT
CATACGTCTACCTCACACTCTCTTTCCGTGACGTGATTCGTTATCTCTCCATCTTCCACCCGCGGTGCAAAGGCG
ACAATCTCTTCGGCTCAGTCAGCGACATTCTCTGCAAGAACCACCCCGCCATACTACTTGGCTTGATGGCATTTA
CGGATTTAATCTTCTTCTTCCTCGACACCTACCTGTTCTACGTCCTCCTGAACACCATATTTTCGATTGCTCGGT
CATTCTATATCGGTTCCTCAATATGGACGCCTTGGCGAAATATCTTTTCTCGCTTGCCGAAACGGATCTACTCCA
AGGTTTTGGCCACGACTGACATGGAGATCAAGTACAAACCCAAGGTCTTGATTTCGCAGGTCTGGAACGCCATTG
TCATTTCCATGTATCGCGAACATCTCCTGGCTATTGATCACGTCCAAAAGCTGCTTTACCATCAGGTCCCGTCCG
AGCAAGAGGGCAAACGCACGTTGCGAGCTCCTACGTTTTTCGTTTCCCAAGAGGACCATTCCTTCAAGACCGAGT
TCTTCCCCAGCCATAGTGAGGCGGAGCGCCGAATCTCCTTCTTTGCTCAGTCGCTGTCCACTCCGATCCCGGAAC
CGCTTCCGGTGGACAACATGCCTACCTTTACGGTCATGATTCCTCATTATAGCGAGAAGATTCTTTTGTCCCTAC
GGGAAATAATTCGTGAAGACGAGCCGTACTCTCGAGTTACACTCCTTGAGTACCTCAAACAGCTGCATCCTCACG
AATGGGACTGCTTCGTCAAGGATACCAAGATCTTGGCCGATGAGACGTCGCAAATGAATGGTGATCTCGAGAAAA
GCGAGAAAGACGCAGCCAAGAGCAAGATTGACGATCTCCCGTTCTATTGCATCGGCTTCAAATCATCAGCTCCGG
AGTACACACTCCGAACCCGCATCTGGGCATCTCTCCGTTCGCAGACGCTTTATCGCACCGTTTCGGGCTTCATGA
ACTACAGTCGTGCGATCAAGCTTCTGTATCGCGTGGAGAACCCAGAGGTTGTTCAGATGTTCGGCGGTAACTCCG
ATAAGCTCGAACGGGAACTTGAGCGCATGGCCCGCCGCAAATTCAAGATAGTCGTCTCCATGCAGCGCTACTCCA
AGTTTAAGAAGGAAGAAATGGAGAATGCTGAATTCTTGCTCCGTGCCTATCCCGACCTCCAGATTGCCTATCTCG
ACGAAGAACCACCTTTGGCCGAAGGCGAGGAGCCTCGGCTCTACTCTGCTCTGATTGACGGTCACTCGGAACTCA
TGGAGAATGGCATGCGACGGCCCAAATTCCGGATTCAGCTTTCCGGCAATCCCGTACTGGGTGATGGCAAGTCCG
ATAATCAAAATCACTCCCTCATTTTCTATCGCGGCGAATATATCCAGCTTATCGACGCCAATCAGGACAATTATC
TAGAGGAGTGTCTCAAAATTCGAAGTGTGCTTGCGGAATTCGAAGAGATGAAAATGGAGAACCTGTCACCATACA
CGCCAGGCGTCAAGAACGAAACCCCCGCACCGGTCGCCATTCTCGGAGCTCGCGAGTACATCTTTTCAGAGAATA
TCGGAATTCTTGGCGACGTCGCTGCTGGCAAAGAGCAGACCTTCGGGACCCTCTTTGCACGTACTCTGGCGCAAA
TTGGAGGCAAACTCCACTATGGGCATCCGGATTTTCTCAATGGCATCTTCATGACTACACGCGGTGGCGTGTCCA
AAGCTCAGAAGGGTCTTCATCTAAACGAAGACATTTTCGCCGGAATGAACGCCATCCTTCGCGGCGGTCGCATCA
AGCACTGCGAATACTATCAGTGCGGCAAAGGTCGTGATCTGGGCTTTGGTTCGATTCTCAATTTCACCACCAAGA
TTGGTACTGGCATGGGTGAACAAATGCTCTCCCGGGAGTACTACTACCTCGGTACTCAACTTCCCCTCGACCGAT
TCTTGTCCTTTTACTACGCGCATCCCGGCTTCCATATCAACAACATGTTCATCATGCTCTCTGTCCAGCTGTTCA
TGCTTACCCTGCTCAACTTCGGCGCTTTTCGCCACGAAACCATTGCCTGCGACTACAATCGAAACAAGCCGCTTA
CGGATCCCCTCTTCCCGACCGGTTGCGCTAATACTGAAGCTATGATGGACTGGGTCAACCGCAGTATCTTATCCA
TCTTCTTCGTGTTCTTCCTGTCTTTCGTTCCCCTGATCGTCCAGGAGCTTACGGAACGGGGTGTCTGGCGCGCGC
TTGTCCGTTTTTTCAAACAGTTCTTCTCACTGTCGCCATTCTTCGAAGTATTCGTCTGCCAGATCTACGCGAACT
CAGTGCAGCAGGATCTTTCGTTTGGTGGTGCGCGATATATCGGAACAGGGCGTGGCTTTGCCACAGCCCGTATCC
CTTTCGGCGTGCTCTACTCTCGATTTGCCGGTCCATCTATCTACTTCGGCGCGAGGCTCTTGATGATCCTATTGT
TCGCCACTGTCACTGCATGGCAAGCGGCCTTGACCTACTTCTGGATCACCTTGCTCGGCCTTACCATCTCCCCCT
TCCTCTACAACCCGCACCAGTTCGCTTGGAACGATTTCTTCATCGACTATCGCGACTTTCTCCGCTGGCTGTCCA
GAGGCAATTCCAGGAGTCATGCGTCATCATGGATCGCTTTCTGCCGTCTGTCGAGAACCCGGATCACTGGTTATA
A

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail