Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1507
Gene name
LocationContig_1331:1181..3397
Strand-
Gene length (bp)2216
Transcript length (bp)2052
Coding sequence length (bp)2052
Protein length (aa) 684

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00319 SRF-TF SRF-type transcription factor (DNA-binding and dimerisation domain) 2.6E-22 11 57

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12224|RLM1_YEAST Transcription factor RLM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RLM1 PE=1 SV=1 1 84 2.0E-27
sp|P38128|SMP1_YEAST Transcription factor SMP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMP1 PE=1 SV=1 1 70 2.0E-26
sp|Q03413|MEF2D_XENLA Myocyte-specific enhancer factor 2D homolog OS=Xenopus laevis GN=mef2d PE=1 SV=1 1 230 2.0E-22
sp|A4UTP7|MEF2C_PIG Myocyte-specific enhancer factor 2C OS=Sus scrofa GN=MEF2C PE=2 SV=1 1 137 9.0E-22
sp|Q63943|MEF2D_MOUSE Myocyte-specific enhancer factor 2D OS=Mus musculus GN=Mef2d PE=1 SV=2 1 230 1.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12224|RLM1_YEAST Transcription factor RLM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RLM1 PE=1 SV=1 1 84 2.0E-27
sp|P38128|SMP1_YEAST Transcription factor SMP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMP1 PE=1 SV=1 1 70 2.0E-26
sp|Q03413|MEF2D_XENLA Myocyte-specific enhancer factor 2D homolog OS=Xenopus laevis GN=mef2d PE=1 SV=1 1 230 2.0E-22
sp|A4UTP7|MEF2C_PIG Myocyte-specific enhancer factor 2C OS=Sus scrofa GN=MEF2C PE=2 SV=1 1 137 9.0E-22
sp|Q63943|MEF2D_MOUSE Myocyte-specific enhancer factor 2D OS=Mus musculus GN=Mef2d PE=1 SV=2 1 230 1.0E-21
sp|O89038|MEF2D_RAT Myocyte-specific enhancer factor 2D OS=Rattus norvegicus GN=Mef2d PE=1 SV=1 1 100 3.0E-21
sp|Q60929|MEF2A_MOUSE Myocyte-specific enhancer factor 2A OS=Mus musculus GN=Mef2a PE=1 SV=2 1 100 4.0E-21
sp|A2VDZ3|MEF2A_BOVIN Myocyte-specific enhancer factor 2A OS=Bos taurus GN=MEF2A PE=2 SV=1 1 130 5.0E-21
sp|Q5REW7|MEF2A_PONAB Myocyte-specific enhancer factor 2A OS=Pongo abelii GN=MEF2A PE=2 SV=1 1 100 6.0E-21
sp|Q02078|MEF2A_HUMAN Myocyte-specific enhancer factor 2A OS=Homo sapiens GN=MEF2A PE=1 SV=1 1 130 6.0E-21
sp|Q2MJT0|MEF2A_RAT Myocyte-specific enhancer factor 2A OS=Rattus norvegicus GN=Mef2a PE=1 SV=1 1 130 6.0E-21
sp|O55087|MEF2B_MOUSE Myocyte-specific enhancer factor 2B OS=Mus musculus GN=Mef2b PE=1 SV=1 1 84 6.0E-21
sp|Q9W6U8|MEF2A_CHICK Myocyte-specific enhancer factor 2A OS=Gallus gallus GN=MEF2A PE=2 SV=1 1 100 8.0E-21
sp|A2ICN5|MEF2A_PIG Myocyte-specific enhancer factor 2A OS=Sus scrofa GN=MEF2A PE=2 SV=2 1 130 2.0E-20
sp|Q8CFN5|MEF2C_MOUSE Myocyte-specific enhancer factor 2C OS=Mus musculus GN=Mef2c PE=1 SV=2 1 84 3.0E-20
sp|Q5R444|MEF2C_PONAB Myocyte-specific enhancer factor 2C OS=Pongo abelii GN=MEF2C PE=2 SV=1 1 84 3.0E-20
sp|Q06413|MEF2C_HUMAN Myocyte-specific enhancer factor 2C OS=Homo sapiens GN=MEF2C PE=1 SV=1 1 84 3.0E-20
sp|Q2KIA0|MEF2C_BOVIN Myocyte-specific enhancer factor 2C OS=Bos taurus GN=MEF2C PE=2 SV=1 1 84 3.0E-20
sp|Q03414|MEF2A_XENLA Myocyte-specific enhancer factor 2A homolog OS=Xenopus laevis GN=mef2a PE=1 SV=2 1 84 4.0E-20
sp|Q02080|MEF2B_HUMAN Myocyte-specific enhancer factor 2B OS=Homo sapiens GN=MEF2B PE=1 SV=2 1 84 8.0E-20
sp|Q9XGJ4|GGM13_GNEGN MADS-box protein GGM13 OS=Gnetum gnemon GN=GGM13 PE=2 SV=1 1 70 1.0E-19
sp|P40791|MEF2_DROME Myocyte-specific enhancer factor 2 OS=Drosophila melanogaster GN=Mef2 PE=1 SV=3 1 69 2.0E-19
sp|Q38836|AGL11_ARATH Agamous-like MADS-box protein AGL11 OS=Arabidopsis thaliana GN=AGL11 PE=1 SV=1 1 70 8.0E-19
sp|Q55F37|SRFC_DICDI Transcription factor mef2A OS=Dictyostelium discoideum GN=mef2A PE=2 SV=2 1 69 1.0E-18
sp|Q38847|AGL15_ARATH Agamous-like MADS-box protein AGL15 OS=Arabidopsis thaliana GN=AGL15 PE=1 SV=1 1 83 3.0E-18
sp|O82794|AGL24_ARATH MADS-box protein AGL24 OS=Arabidopsis thaliana GN=AGL24 PE=1 SV=1 1 74 5.0E-18
sp|P29381|AGL1_ARATH Agamous-like MADS-box protein AGL1 OS=Arabidopsis thaliana GN=AGL1 PE=1 SV=1 1 70 5.0E-18
sp|Q40168|AG_SOLLC Floral homeotic protein AGAMOUS OS=Solanum lycopersicum GN=AG1 PE=2 SV=1 1 70 5.0E-18
sp|Q40704|MADS3_ORYSJ MADS-box transcription factor 3 OS=Oryza sativa subsp. japonica GN=MADS3 PE=2 SV=1 1 70 6.0E-18
sp|P29385|AGL5_ARATH Agamous-like MADS-box protein AGL5 OS=Arabidopsis thaliana GN=AGL5 PE=1 SV=1 1 70 6.0E-18
sp|Q03489|AGL9_PETHY Agamous-like MADS-box protein AGL9 homolog OS=Petunia hybrida GN=FBP2 PE=1 SV=2 1 70 7.0E-18
sp|P17839|AG_ARATH Floral homeotic protein AGAMOUS OS=Arabidopsis thaliana GN=AG PE=1 SV=2 2 86 1.0E-17
sp|Q9FUY6|JOIN_SOLLC MADS-box protein JOINTLESS OS=Solanum lycopersicum GN=J PE=1 SV=1 1 72 1.0E-17
sp|Q8VWM8|M17_MAIZE MADS-box protein ZMM17 OS=Zea mays GN=M17 PE=2 SV=1 1 74 1.0E-17
sp|Q39295|AGL15_BRANA Agamous-like MADS-box protein AGL15 OS=Brassica napus GN=AGL15 PE=3 SV=1 1 69 2.0E-17
sp|Q01540|AG_BRANA Floral homeotic protein AGAMOUS OS=Brassica napus GN=AG1 PE=2 SV=1 2 86 2.0E-17
sp|O22456|SEP3_ARATH Developmental protein SEPALLATA 3 OS=Arabidopsis thaliana GN=SEP3 PE=1 SV=1 1 70 2.0E-17
sp|P29382|SEP1_ARATH Developmental protein SEPALLATA 1 OS=Arabidopsis thaliana GN=SEP1 PE=1 SV=2 1 70 2.0E-17
sp|Q40885|AG_PETHY Floral homeotic protein AGAMOUS OS=Petunia hybrida GN=AG1 PE=1 SV=1 1 70 3.0E-17
sp|Q43585|AG_TOBAC Floral homeotic protein AGAMOUS OS=Nicotiana tabacum GN=AG1 PE=2 SV=1 1 70 4.0E-17
sp|Q40872|AG_PANGI Floral homeotic protein AGAMOUS OS=Panax ginseng GN=AG2 PE=2 SV=1 1 70 4.0E-17
sp|Q9FVC1|SVP_ARATH MADS-box protein SVP OS=Arabidopsis thaliana GN=SVP PE=1 SV=1 1 72 4.0E-17
sp|O04067|AGL9_SINAL Agamous-like MADS-box protein AGL9 homolog OS=Sinapis alba GN=AGL9 PE=2 SV=1 1 70 4.0E-17
sp|Q84NC5|MAD25_ORYSJ MADS-box transcription factor 25 OS=Oryza sativa subsp. japonica GN=MADS25 PE=2 SV=2 1 78 4.0E-17
sp|Q6EU39|MADS6_ORYSJ MADS-box transcription factor 6 OS=Oryza sativa subsp. japonica GN=MADS6 PE=1 SV=1 1 76 6.0E-17
sp|Q2V0P1|MAD58_ORYSJ MADS-box transcription factor 58 OS=Oryza sativa subsp. japonica GN=MADS58 PE=2 SV=1 3 70 6.0E-17
sp|Q39685|CMB1_DIACA MADS-box protein CMB1 OS=Dianthus caryophyllus GN=CMB1 PE=2 SV=1 1 70 6.0E-17
sp|Q6VAM4|MAD23_ORYSJ MADS-box transcription factor 23 OS=Oryza sativa subsp. japonica GN=MADS23 PE=2 SV=1 1 69 9.0E-17
sp|Q9M2K8|AGL18_ARATH Agamous-like MADS-box protein AGL18 OS=Arabidopsis thaliana GN=AGL18 PE=2 SV=1 1 108 9.0E-17
sp|O65874|MTF1_PEA MADS-box transcription factor 1 OS=Pisum sativum GN=MTF1 PE=2 SV=1 1 70 1.0E-16
sp|Q0J466|MADS7_ORYSJ MADS-box transcription factor 7 OS=Oryza sativa subsp. japonica GN=MADS7 PE=1 SV=2 1 70 1.0E-16
sp|P0C5B0|MADS7_ORYSI MADS-box transcription factor 7 OS=Oryza sativa subsp. indica GN=MADS7 PE=2 SV=2 1 70 1.0E-16
sp|P29384|SEP2_ARATH Developmental protein SEPALLATA 2 OS=Arabidopsis thaliana GN=SEP2 PE=1 SV=1 1 70 1.0E-16
sp|Q9SAR1|MADS8_ORYSJ MADS-box transcription factor 8 OS=Oryza sativa subsp. japonica GN=MADS8 PE=1 SV=1 1 70 1.0E-16
sp|Q6H711|MAD29_ORYSJ MADS-box transcription factor 29 OS=Oryza sativa subsp. japonica GN=MADS29 PE=2 SV=1 1 70 1.0E-16
sp|Q0D4T4|MAD18_ORYSJ MADS-box transcription factor 18 OS=Oryza sativa subsp. japonica GN=MADS18 PE=1 SV=1 1 70 1.0E-16
sp|A2YNI2|MAD18_ORYSI MADS-box transcription factor 18 OS=Oryza sativa subsp. indica GN=MADS18 PE=2 SV=2 1 70 1.0E-16
sp|P29383|AGL3_ARATH Agamous-like MADS-box protein AGL3 OS=Arabidopsis thaliana GN=AGL3 PE=2 SV=2 1 75 1.0E-16
sp|P0DI14|AP1_BRARP Floral homeotic protein APETALA 1 OS=Brassica rapa subsp. pekinensis GN=AP1 PE=3 SV=1 1 75 2.0E-16
sp|Q8GTF4|AP1C_BRAOB Floral homeotic protein APETALA 1 C OS=Brassica oleracea var. botrytis GN=AP1C PE=2 SV=1 1 75 2.0E-16
sp|B4YPV4|AP1C_BRAOA Floral homeotic protein APETALA 1 C OS=Brassica oleracea var. alboglabra GN=AP1C PE=3 SV=1 1 75 2.0E-16
sp|Q96355|1AP1_BRAOT Floral homeotic protein APETALA 1-1 OS=Brassica oleracea var. italica GN=1AP1 PE=2 SV=1 1 75 2.0E-16
sp|O22328|AGL8_SOLCO Agamous-like MADS-box protein AGL8 homolog OS=Solanum commersonii GN=SCM1 PE=2 SV=1 1 83 3.0E-16
sp|Q38694|AGL9_ARADE Agamous-like MADS-box protein AGL9 homolog OS=Aranda deborah PE=2 SV=1 1 70 4.0E-16
sp|Q9SBK9|CAL_BRARP Transcription factor CAULIFLOWER OS=Brassica rapa subsp. pekinensis GN=CAL PE=2 SV=1 1 75 6.0E-16
sp|Q42429|AGL8_SOLTU Agamous-like MADS-box protein AGL8 homolog OS=Solanum tuberosum PE=2 SV=1 1 83 6.0E-16
sp|Q6R4S3|CAL_BRARR Transcription factor CAULIFLOWER OS=Brassica rapa subsp. rapa GN=CAL PE=2 SV=1 1 75 6.0E-16
sp|Q6R4S6|CAL_BRARC Transcription factor CAULIFLOWER OS=Brassica rapa subsp. chinensis GN=CAL PE=2 SV=1 1 75 6.0E-16
sp|Q6EP49|MAD27_ORYSJ MADS-box transcription factor 27 OS=Oryza sativa subsp. japonica GN=MADS27 PE=2 SV=2 1 69 6.0E-16
sp|Q39371|3AP1_BRAOL Floral homeotic protein APETALA 1 OS=Brassica oleracea GN=AP1 PE=2 SV=1 1 75 8.0E-16
sp|Q42464|AGL9_SOLLC Agamous-like MADS-box protein AGL9 homolog OS=Solanum lycopersicum GN=TDR5 PE=2 SV=1 1 70 8.0E-16
sp|P29386|AGL6_ARATH Agamous-like MADS-box protein AGL6 OS=Arabidopsis thaliana GN=AGL6 PE=1 SV=2 1 69 9.0E-16
sp|Q6R4R6|CALD_BRAOB Truncated transcription factor CAULIFLOWER D OS=Brassica oleracea var. botrytis GN=CAL-D PE=2 SV=1 1 81 1.0E-15
sp|Q6R4R7|CALC_BRAOB Truncated transcription factor CAULIFLOWER C OS=Brassica oleracea var. botrytis GN=CAL-C PE=2 SV=1 1 81 1.0E-15
sp|Q6R4R9|CALA_BRAOB Truncated transcription factor CAULIFLOWER A OS=Brassica oleracea var. botrytis GN=CAL-A PE=2 SV=2 1 81 1.0E-15
sp|A2RVQ5|AGL16_ARATH Agamous-like MADS-box protein AGL16 OS=Arabidopsis thaliana GN=AGL16 PE=1 SV=1 1 69 1.0E-15
sp|Q6R4R8|CALB_BRAOB Truncated transcription factor CAULIFLOWER B OS=Brassica oleracea var. botrytis GN=CAL-B PE=2 SV=1 1 81 1.0E-15
sp|Q10CQ1|MAD14_ORYSJ MADS-box transcription factor 14 OS=Oryza sativa subsp. japonica GN=MADS14 PE=1 SV=2 1 75 1.0E-15
sp|D7KWY6|AP1_ARALL Floral homeotic protein APETALA 1 OS=Arabidopsis lyrata subsp. lyrata GN=AP1 PE=3 SV=1 1 75 1.0E-15
sp|Q41274|AGL8_SINAL Agamous-like MADS-box protein AGL8 homolog OS=Sinapis alba GN=AGL8 PE=2 SV=1 1 69 2.0E-15
sp|Q41276|AP1_SINAL Floral homeotic protein APETALA 1 OS=Sinapis alba GN=AP1 PE=2 SV=1 1 75 2.0E-15
sp|Q6Z6W2|MAD57_ORYSJ MADS-box transcription factor 57 OS=Oryza sativa subsp. japonica GN=MADS57 PE=2 SV=2 1 69 2.0E-15
sp|P35631|AP1_ARATH Floral homeotic protein APETALA 1 OS=Arabidopsis thaliana GN=AP1 PE=1 SV=2 1 75 2.0E-15
sp|Q8GTF5|AP1A_BRAOB Floral homeotic protein APETALA 1 A OS=Brassica oleracea var. botrytis GN=AP1A PE=2 SV=1 1 75 2.0E-15
sp|B4YPW6|AP1A_BRAOA Floral homeotic protein APETALA 1 A OS=Brassica oleracea var. alboglabra GN=AP1A PE=3 SV=1 1 75 2.0E-15
sp|Q96356|2AP1_BRAOT Floral homeotic protein APETALA 1-2 OS=Brassica oleracea var. italica GN=2AP1 PE=2 SV=1 1 75 2.0E-15
sp|Q8RU31|MAD21_ORYSJ MADS-box transcription factor 21 OS=Oryza sativa subsp. japonica GN=MADS21 PE=2 SV=1 1 70 3.0E-15
sp|Q38876|AGL8_ARATH Agamous-like MADS-box protein AGL8 OS=Arabidopsis thaliana GN=AGL8 PE=1 SV=1 1 69 3.0E-15
sp|Q7XUN2|MAD17_ORYSJ MADS-box transcription factor 17 OS=Oryza sativa subsp. japonica GN=MADS17 PE=1 SV=2 1 69 3.0E-15
sp|A2IB53|AP1_CITSI Floral homeotic protein APETALA 1 OS=Citrus sinensis GN=AP1 PE=2 SV=1 1 75 5.0E-15
sp|Q2QW53|MAD13_ORYSJ MADS-box transcription factor 13 OS=Oryza sativa subsp. japonica GN=MADS13 PE=1 SV=2 1 70 5.0E-15
sp|Q39081|CAL_ARATH Transcription factor CAULIFLOWER OS=Arabidopsis thaliana GN=CAL PE=1 SV=3 1 75 6.0E-15
sp|Q9SZJ6|AGL21_ARATH Agamous-like MADS-box protein AGL21 OS=Arabidopsis thaliana GN=AGL21 PE=1 SV=1 1 69 7.0E-15
sp|P0C5B1|MAD14_ORYSI MADS-box transcription factor 14 OS=Oryza sativa subsp. indica GN=MADS14 PE=2 SV=1 1 75 7.0E-15
sp|Q39375|CAL_BRAOT Transcription factor CAULIFLOWER OS=Brassica oleracea var. italica GN=CAL PE=2 SV=1 1 75 7.0E-15
sp|Q6Q9I2|MAD15_ORYSJ MADS-box transcription factor 15 OS=Oryza sativa subsp. japonica GN=MADS15 PE=1 SV=2 1 75 9.0E-15
sp|Q40170|AGL8_SOLLC Agamous-like MADS-box protein AGL8 homolog OS=Solanum lycopersicum GN=TDR4 PE=2 SV=1 1 83 1.0E-14
sp|Q9ATE5|FBP24_PETHY MADS-box protein FBP24 OS=Petunia hybrida GN=FBP24 PE=1 SV=1 1 69 1.0E-14
sp|Q9SI38|ANR1_ARATH MADS-box transcription factor ANR1 OS=Arabidopsis thaliana GN=ANR1 PE=1 SV=1 1 69 1.0E-14
sp|Q03416|GLOB_TOBAC Floral homeotic protein GLOBOSA OS=Nicotiana tabacum GN=GLO PE=2 SV=1 1 70 1.0E-14
sp|Q03488|FBP1_PETHY Floral homeotic protein FBP1 OS=Petunia hybrida GN=FBP1 PE=2 SV=1 1 70 1.0E-14
sp|O64645|SOC1_ARATH MADS-box protein SOC1 OS=Arabidopsis thaliana GN=SOC1 PE=1 SV=1 1 72 2.0E-14
sp|Q9XJ66|MAD22_ORYSJ MADS-box transcription factor 22 OS=Oryza sativa subsp. japonica GN=MADS22 PE=2 SV=1 1 72 2.0E-14
sp|O82743|AGL19_ARATH Agamous-like MADS-box protein AGL19 OS=Arabidopsis thaliana GN=AGL19 PE=1 SV=1 1 79 2.0E-14
sp|Q9HGP0|PVG4_SCHPO MADS-box transcription factor pvg4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pvg4 PE=3 SV=1 1 68 2.0E-14
sp|Q38837|AGL13_ARATH Agamous-like MADS-box protein AGL13 OS=Arabidopsis thaliana GN=AGL13 PE=2 SV=2 1 69 4.0E-14
sp|Q10PZ9|MADS1_ORYSJ MADS-box transcription factor 1 OS=Oryza sativa subsp. japonica GN=MADS1 PE=1 SV=1 1 70 4.0E-14
sp|A2XDY1|MADS1_ORYSI MADS-box transcription factor 1 OS=Oryza sativa subsp. indica GN=MADS1 PE=2 SV=2 1 70 4.0E-14
sp|D7KQR8|CAL_ARALL Transcription factor CAULIFLOWER OS=Arabidopsis lyrata subsp. lyrata GN=CAL PE=3 SV=1 1 75 5.0E-14
sp|Q9FPN7|AGL31_ARATH Agamous-like MADS-box protein AGL31 OS=Arabidopsis thaliana GN=AGL31 PE=2 SV=2 1 72 8.0E-14
sp|Q38840|AGL17_ARATH Agamous-like MADS-box protein AGL17 OS=Arabidopsis thaliana GN=AGL17 PE=2 SV=2 1 69 8.0E-14
sp|Q40702|MADS2_ORYSJ MADS-box transcription factor 2 OS=Oryza sativa subsp. japonica GN=MADS2 PE=2 SV=1 1 70 1.0E-13
sp|Q1PFC2|AGL66_ARATH Agamous-like MADS-box protein AGL66 OS=Arabidopsis thaliana GN=AGL66 PE=1 SV=1 1 69 1.0E-13
sp|Q683D7|MAF5_ARATH Protein MADS AFFECTING FLOWERING 5 OS=Arabidopsis thaliana GN=MAF5 PE=2 SV=2 1 72 1.0E-13
sp|Q8RVL4|DEF21_ANTMA MADS-box protein defh21 OS=Antirrhinum majus GN=DEFH21 PE=2 SV=1 1 69 2.0E-13
sp|Q07474|MADS2_PETHY Floral homeotic protein PMADS 2 OS=Petunia hybrida GN=PMADS2 PE=2 SV=1 1 70 2.0E-13
sp|Q2QW55|MAD33_ORYSJ MADS-box transcription factor 33 OS=Oryza sativa subsp. japonica GN=MADS33 PE=2 SV=2 1 70 2.0E-13
sp|Q6Q9H6|MAD34_ORYSJ MADS-box transcription factor 34 OS=Oryza sativa subsp. japonica GN=MADS34 PE=2 SV=2 1 77 2.0E-13
sp|P35632|AP3_ARATH Floral homeotic protein APETALA 3 OS=Arabidopsis thaliana GN=AP3 PE=1 SV=1 1 70 2.0E-13
sp|Q0DEB8|MADS5_ORYSJ MADS-box transcription factor 5 OS=Oryza sativa subsp. japonica GN=MADS5 PE=1 SV=1 1 70 3.0E-13
sp|A2Y9P0|MADS5_ORYSI MADS-box transcription factor 5 OS=Oryza sativa subsp. indica GN=MADS5 PE=2 SV=1 1 70 3.0E-13
sp|Q2QQA3|MAD20_ORYSJ MADS-box transcription factor 20 OS=Oryza sativa subsp. japonica GN=MADS20 PE=2 SV=2 1 77 3.0E-13
sp|Q9LM46|AG104_ARATH Agamous-like MADS-box protein AGL104 OS=Arabidopsis thaliana GN=AGL104 PE=1 SV=1 1 69 4.0E-13
sp|Q5K4R0|MAD47_ORYSJ MADS-box transcription factor 47 OS=Oryza sativa subsp. japonica GN=MADS47 PE=1 SV=2 3 90 6.0E-13
sp|Q84NC2|MAD31_ORYSJ MADS-box transcription factor 31 OS=Oryza sativa subsp. japonica GN=MADS31 PE=2 SV=1 1 69 7.0E-13
sp|P48007|PIST_ARATH Floral homeotic protein PISTILLATA OS=Arabidopsis thaliana GN=PI PE=1 SV=1 1 70 9.0E-13
sp|P23706|DEFA_ANTMA Floral homeotic protein DEFICIENS OS=Antirrhinum majus GN=DEFA PE=1 SV=1 1 70 1.0E-12
sp|Q944S9|MAD16_ORYSJ MADS-box transcription factor 16 OS=Oryza sativa subsp. japonica GN=MADS16 PE=1 SV=2 1 70 1.0E-12
sp|Q655V4|MAD30_ORYSJ MADS-box transcription factor 30 OS=Oryza sativa subsp. japonica GN=MADS30 PE=2 SV=1 1 71 3.0E-12
sp|Q0J8G8|MAD26_ORYSJ MADS-box transcription factor 26 OS=Oryza sativa subsp. japonica GN=MADS26 PE=2 SV=1 1 70 4.0E-12
sp|A2YQK9|MAD26_ORYSI MADS-box transcription factor 26 OS=Oryza sativa subsp. indica GN=MADS26 PE=2 SV=2 1 70 4.0E-12
sp|Q9S7Q7|FLC_ARATH MADS-box protein FLOWERING LOCUS C OS=Arabidopsis thaliana GN=FLC PE=2 SV=1 1 69 5.0E-12
sp|Q38838|AGL14_ARATH Agamous-like MADS-box protein AGL14 OS=Arabidopsis thaliana GN=AGL14 PE=1 SV=2 1 70 6.0E-12
sp|Q69TG5|MAD55_ORYSJ MADS-box transcription factor 55 OS=Oryza sativa subsp. japonica GN=MADS55 PE=2 SV=2 17 72 8.0E-12
sp|Q9XJ60|MAD50_ORYSJ MADS-box transcription factor 50 OS=Oryza sativa subsp. japonica GN=MADS50 PE=2 SV=1 1 76 9.0E-12
sp|Q03378|GLOB_ANTMA Floral homeotic protein GLOBOSA OS=Antirrhinum majus GN=GLO PE=1 SV=1 1 68 2.0E-11
sp|Q54QY7|SRFD_DICDI Serum factor response D OS=Dictyostelium discoideum GN=srfD PE=3 SV=1 1 62 3.0E-11
sp|Q8RYD9|TT16_ARATH Protein TRANSPARENT TESTA 16 OS=Arabidopsis thaliana GN=TT16 PE=1 SV=1 1 69 3.0E-11
sp|O64703|AGL29_ARATH Agamous-like MADS-box protein AGL29 OS=Arabidopsis thaliana GN=AGL29 PE=2 SV=1 1 69 1.0E-10
sp|P0C5B2|MAD56_ORYSJ MADS-box transcription factor 56 OS=Oryza sativa subsp. japonica GN=MADS56 PE=2 SV=1 1 70 3.0E-10
sp|Q38841|AGL12_ARATH Agamous-like MADS-box protein AGL12 OS=Arabidopsis thaliana GN=AGL12 PE=2 SV=2 1 69 3.0E-10
sp|A2Z9Q7|MAD56_ORYSI MADS-box transcription factor 56 OS=Oryza sativa subsp. indica GN=MADS56 PE=2 SV=2 1 70 3.0E-10
sp|Q40703|MADS4_ORYSJ MADS-box transcription factor 4 OS=Oryza sativa subsp. japonica GN=MADS4 PE=1 SV=3 1 59 4.0E-10
sp|Q5AFP3|MCM1_CANAL Transcription factor of morphogenesis MCM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MCM1 PE=1 SV=1 3 105 4.0E-10
sp|Q42498|CMB2_DIACA MADS-box protein CMB2 OS=Dianthus caryophyllus GN=CMB2 PE=2 SV=1 1 70 4.0E-10
sp|Q9AT76|AGL27_ARATH Agamous-like MADS-box protein AGL27 OS=Arabidopsis thaliana GN=AGL27 PE=1 SV=1 1 72 5.0E-10
sp|Q8S151|MAD32_ORYSJ MADS-box transcription factor 32 OS=Oryza sativa subsp. japonica GN=MADS32 PE=2 SV=1 1 70 5.0E-10
sp|Q07472|MADS1_PETHY Floral homeotic protein PMADS 1 OS=Petunia hybrida GN=PMADS1 PE=2 SV=1 1 59 8.0E-10
sp|Q9FKK2|AGL62_ARATH Agamous-like MADS-box protein AGL62 OS=Arabidopsis thaliana GN=AGL62 PE=1 SV=1 2 69 1.0E-09
sp|Q7X9I0|AGL65_ARATH Agamous-like MADS-box protein AGL65 OS=Arabidopsis thaliana GN=AGL65 PE=1 SV=1 1 48 1.0E-09
sp|Q9LMM8|AGL28_ARATH Agamous-like MADS-box protein AGL28 OS=Arabidopsis thaliana GN=AGL28 PE=2 SV=1 1 48 3.0E-09
sp|Q1PFA4|AGL30_ARATH Agamous-like MADS-box protein AGL30 OS=Arabidopsis thaliana GN=AGL30 PE=1 SV=1 1 48 4.0E-09
sp|P11746|MCM1_YEAST Pheromone receptor transcription factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM1 PE=1 SV=2 3 59 3.0E-08
sp|O80807|AGL23_ARATH Agamous-like MADS-box protein AGL23 OS=Arabidopsis thaliana GN=AGL23 PE=2 SV=1 1 70 3.0E-08
sp|O42954|MBX1_SCHPO MADS-box transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mbx1 PE=1 SV=2 8 61 5.0E-08
sp|Q54TY7|SRFA_DICDI Serum response factor homolog A OS=Dictyostelium discoideum GN=srfA PE=1 SV=1 2 68 1.0E-07
sp|Q4PSU4|AGL61_ARATH Agamous-like MADS-box protein AGL61 OS=Arabidopsis thaliana GN=AGL61 PE=1 SV=1 1 69 3.0E-07
sp|Q54RY6|SRFB_DICDI Serum response factor homolog B OS=Dictyostelium discoideum GN=srfB PE=3 SV=1 2 68 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0046983 protein dimerization activity Yes
GO:1901363 heterocyclic compound binding No
GO:0005515 protein binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
MADS-box

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1507
MGRRKIEIKAIKDDRNRSVTFLKRKGGLFKKAHELSVLCSVDVAVFIFGNNKKLYEYSSSDMRDLIHRYQLHGTA
NEHKGPADFNGGNDDDDDDDADGSPPRAPAGVEPQMMPPQFHGQQPPFSQILRHHTPSASPPITHGVPFQGHHPG
HHNPRGATPQPTAIDPRPSSRNDARRIGPNMAAAQPVGGPHASHPVGGPHASHPGITYMPTPPIYNPAAGQPGIL
PQHAGQYSYPHPHQQQPHPHQQQQHPHQQHPHPHPHPPYVEDRRPSAPPGYPAQHPPPRPPPPSQTAPAAVARPE
PSPPQPGAHHLPPHPVPQVSPPTPQPAPERRPQEPHPPPPPVEPKTEPSDRPQPPLLNTDMAIKKMPQRKSHSIF
TPIEENRSILSRHLASFAADTPPVKSESGAAGVAGAGGVAPPSHRSQSLDASASRDGVPTSPQLKRSSTQSSLDK
TRNASVSSGPDSTFTPPSRANSLKAVAGARPRGPRLTVQIPDGASEPGSATGESNSPHNPAVTPTHTPQRHNSHS
SVVLPPPSPSASALLSAGASGPPNPFARPPPQQNVNGETPVSALPSRFLNHELLHSPSSFYQDWSFRGSDNNAMP
SPLNFATPVVGSGPSFLREDHHAGSSGNVAHGSAAVSNGGGGGGGQNILSGPAKRKSPDFGSSGHGEAHAAPNEP
KRVKVEYA*
Coding >Hirsu2|1507
ATGGGGCGCAGAAAGATCGAGATCAAGGCCATCAAGGACGACCGCAATCGCTCAGTCACCTTCCTCAAGCGAAAA
GGAGGTCTCTTCAAGAAGGCCCACGAGCTGTCCGTCCTGTGTTCCGTCGACGTCGCCGTCTTCATCTTCGGCAAC
AACAAGAAGCTGTATGAGTACTCGTCCTCGGACATGCGCGACCTCATCCACCGATATCAACTCCACGGCACCGCC
AACGAGCACAAGGGCCCCGCCGACTTCAACGGCGGCAACGACGATGACGACGACGACGATGCCGACGGAAGCCCT
CCCCGCGCCCCCGCCGGCGTCGAGCCCCAGATGATGCCTCCCCAGTTCCACGGCCAGCAGCCGCCCTTCTCCCAG
ATCCTCCGCCACCACACGCCCTCGGCCTCGCCCCCCATCACCCACGGCGTCCCCTTCCAGGGCCACCATCCAGGC
CACCACAACCCCCGCGGCGCCACGCCCCAGCCGACAGCCATCGATCCGCGCCCCAGCTCCCGGAACGACGCCCGT
CGCATCGGGCCCAACATGGCCGCCGCCCAGCCCGTCGGAGGCCCCCACGCCTCTCATCCCGTCGGGGGCCCCCAC
GCCTCCCATCCCGGCATCACCTACATGCCCACGCCGCCCATCTACAACCCGGCCGCCGGCCAGCCCGGCATCCTG
CCCCAGCACGCGGGCCAGTATTCCTATCCCCACCCGCACCAGCAACAACCGCATCCGCACCAGCAGCAACAGCAC
CCGCACCAGCAGCACCCGCACCCGCACCCTCATCCGCCCTACGTCGAGGACCGGCGTCCCTCGGCGCCCCCGGGC
TACCCGGCGCAGCATCCGCCCCCCCGGCCGCCGCCTCCGTCCCAGACCGCTCCCGCCGCCGTCGCCCGCCCGGAA
CCGTCCCCGCCCCAGCCCGGCGCGCACCACCTGCCTCCCCACCCCGTGCCTCAAGTCTCCCCCCCGACGCCCCAA
CCCGCCCCGGAGCGCCGGCCGCAGGAGCCCCACCCCCCTCCGCCGCCCGTCGAGCCCAAGACGGAGCCCTCGGAT
CGACCGCAGCCGCCCTTGCTGAACACGGACATGGCCATCAAGAAGATGCCCCAACGCAAGTCCCACAGCATCTTC
ACGCCCATCGAGGAGAATCGGTCCATCCTGTCCCGGCACCTGGCGTCCTTCGCTGCCGACACGCCGCCCGTCAAG
AGCGAGTCTGGCGCTGCGGGGGTGGCCGGCGCCGGCGGCGTTGCGCCACCGTCGCACCGGTCTCAGTCGCTCGAC
GCCTCCGCCTCACGCGACGGGGTTCCGACCTCGCCGCAGCTGAAGCGCTCCAGCACGCAGAGCAGCCTTGACAAG
ACCCGCAACGCCTCGGTGTCGTCGGGCCCGGACAGCACCTTCACGCCGCCGTCGCGGGCCAACAGTCTCAAGGCG
GTGGCCGGCGCGCGCCCGAGGGGTCCCCGGCTCACGGTGCAGATACCCGACGGCGCGTCGGAGCCCGGCAGCGCC
ACCGGCGAGTCCAACTCGCCGCACAACCCCGCCGTCACCCCGACGCATACTCCGCAGCGGCACAACTCGCACTCG
TCCGTCGTCCTCCCGCCCCCGTCGCCCTCGGCCTCGGCGCTGCTCTCGGCCGGCGCTTCCGGTCCGCCCAACCCC
TTCGCCCGGCCGCCGCCCCAGCAGAACGTCAACGGCGAGACGCCCGTGTCGGCCCTCCCCTCGCGCTTCCTCAAC
CACGAGCTGCTGCACAGCCCCAGCAGCTTCTACCAGGACTGGAGCTTTCGCGGCAGCGACAACAACGCCATGCCG
AGCCCGCTGAACTTTGCCACCCCGGTCGTCGGCTCCGGTCCGAGCTTCTTGCGGGAGGACCACCATGCGGGCTCC
TCCGGCAACGTCGCCCACGGGTCCGCGGCCGTCTCCAACGGGGGCGGCGGCGGCGGCGGTCAGAACATCCTGTCG
GGCCCCGCGAAGCGCAAGTCTCCCGACTTTGGCAGCAGCGGGCACGGTGAGGCTCACGCGGCGCCCAACGAGCCC
AAGAGGGTCAAAGTCGAGTACGCCTAA
Transcript >Hirsu2|1507
ATGGGGCGCAGAAAGATCGAGATCAAGGCCATCAAGGACGACCGCAATCGCTCAGTCACCTTCCTCAAGCGAAAA
GGAGGTCTCTTCAAGAAGGCCCACGAGCTGTCCGTCCTGTGTTCCGTCGACGTCGCCGTCTTCATCTTCGGCAAC
AACAAGAAGCTGTATGAGTACTCGTCCTCGGACATGCGCGACCTCATCCACCGATATCAACTCCACGGCACCGCC
AACGAGCACAAGGGCCCCGCCGACTTCAACGGCGGCAACGACGATGACGACGACGACGATGCCGACGGAAGCCCT
CCCCGCGCCCCCGCCGGCGTCGAGCCCCAGATGATGCCTCCCCAGTTCCACGGCCAGCAGCCGCCCTTCTCCCAG
ATCCTCCGCCACCACACGCCCTCGGCCTCGCCCCCCATCACCCACGGCGTCCCCTTCCAGGGCCACCATCCAGGC
CACCACAACCCCCGCGGCGCCACGCCCCAGCCGACAGCCATCGATCCGCGCCCCAGCTCCCGGAACGACGCCCGT
CGCATCGGGCCCAACATGGCCGCCGCCCAGCCCGTCGGAGGCCCCCACGCCTCTCATCCCGTCGGGGGCCCCCAC
GCCTCCCATCCCGGCATCACCTACATGCCCACGCCGCCCATCTACAACCCGGCCGCCGGCCAGCCCGGCATCCTG
CCCCAGCACGCGGGCCAGTATTCCTATCCCCACCCGCACCAGCAACAACCGCATCCGCACCAGCAGCAACAGCAC
CCGCACCAGCAGCACCCGCACCCGCACCCTCATCCGCCCTACGTCGAGGACCGGCGTCCCTCGGCGCCCCCGGGC
TACCCGGCGCAGCATCCGCCCCCCCGGCCGCCGCCTCCGTCCCAGACCGCTCCCGCCGCCGTCGCCCGCCCGGAA
CCGTCCCCGCCCCAGCCCGGCGCGCACCACCTGCCTCCCCACCCCGTGCCTCAAGTCTCCCCCCCGACGCCCCAA
CCCGCCCCGGAGCGCCGGCCGCAGGAGCCCCACCCCCCTCCGCCGCCCGTCGAGCCCAAGACGGAGCCCTCGGAT
CGACCGCAGCCGCCCTTGCTGAACACGGACATGGCCATCAAGAAGATGCCCCAACGCAAGTCCCACAGCATCTTC
ACGCCCATCGAGGAGAATCGGTCCATCCTGTCCCGGCACCTGGCGTCCTTCGCTGCCGACACGCCGCCCGTCAAG
AGCGAGTCTGGCGCTGCGGGGGTGGCCGGCGCCGGCGGCGTTGCGCCACCGTCGCACCGGTCTCAGTCGCTCGAC
GCCTCCGCCTCACGCGACGGGGTTCCGACCTCGCCGCAGCTGAAGCGCTCCAGCACGCAGAGCAGCCTTGACAAG
ACCCGCAACGCCTCGGTGTCGTCGGGCCCGGACAGCACCTTCACGCCGCCGTCGCGGGCCAACAGTCTCAAGGCG
GTGGCCGGCGCGCGCCCGAGGGGTCCCCGGCTCACGGTGCAGATACCCGACGGCGCGTCGGAGCCCGGCAGCGCC
ACCGGCGAGTCCAACTCGCCGCACAACCCCGCCGTCACCCCGACGCATACTCCGCAGCGGCACAACTCGCACTCG
TCCGTCGTCCTCCCGCCCCCGTCGCCCTCGGCCTCGGCGCTGCTCTCGGCCGGCGCTTCCGGTCCGCCCAACCCC
TTCGCCCGGCCGCCGCCCCAGCAGAACGTCAACGGCGAGACGCCCGTGTCGGCCCTCCCCTCGCGCTTCCTCAAC
CACGAGCTGCTGCACAGCCCCAGCAGCTTCTACCAGGACTGGAGCTTTCGCGGCAGCGACAACAACGCCATGCCG
AGCCCGCTGAACTTTGCCACCCCGGTCGTCGGCTCCGGTCCGAGCTTCTTGCGGGAGGACCACCATGCGGGCTCC
TCCGGCAACGTCGCCCACGGGTCCGCGGCCGTCTCCAACGGGGGCGGCGGCGGCGGCGGTCAGAACATCCTGTCG
GGCCCCGCGAAGCGCAAGTCTCCCGACTTTGGCAGCAGCGGGCACGGTGAGGCTCACGCGGCGCCCAACGAGCCC
AAGAGGGTCAAAGTCGAGTACGCCTAA
Gene >Hirsu2|1507
ATGGGGCGCAGAAAGATCGAGATCAAGGCCATCAAGGACGACCGCAATCGCTCAGTGTACGTCTTTCCCCGTCCA
TGGCTCTGTCCCGACCTCGTTGCTGACGCCCCCTGGCCCCTTTTCTCTCCAGCACCTTCCTCAAGCGAAAAGGAG
GTCTCTTCAAGAAGGCCCACGAGCTGTCCGTCCTGTGTTCCGTCGACGTCGCCGTCTTCATCTTCGGCAACAACA
AGAAGCTGTATGAGTACTCGTCCTCGGACATGCGCGACCTCATCCACCGATATCAACTCGTGAGTCTCCCGTCCT
TTGCCCGACAGGTGGGCAAAGAAGCAAGCAAGCACGACCATGGCCCGTGGCGCGAGACTCGCTGACGCGTCGCAC
AGCACGGCACCGCCAACGAGCACAAGGGCCCCGCCGACTTCAACGGCGGCAACGACGATGACGACGACGACGATG
CCGACGGAAGCCCTCCCCGCGCCCCCGCCGGCGTCGAGCCCCAGATGATGCCTCCCCAGTTCCACGGCCAGCAGC
CGCCCTTCTCCCAGATCCTCCGCCACCACACGCCCTCGGCCTCGCCCCCCATCACCCACGGCGTCCCCTTCCAGG
GCCACCATCCAGGCCACCACAACCCCCGCGGCGCCACGCCCCAGCCGACAGCCATCGATCCGCGCCCCAGCTCCC
GGAACGACGCCCGTCGCATCGGGCCCAACATGGCCGCCGCCCAGCCCGTCGGAGGCCCCCACGCCTCTCATCCCG
TCGGGGGCCCCCACGCCTCCCATCCCGGCATCACCTACATGCCCACGCCGCCCATCTACAACCCGGCCGCCGGCC
AGCCCGGCATCCTGCCCCAGCACGCGGGCCAGTATTCCTATCCCCACCCGCACCAGCAACAACCGCATCCGCACC
AGCAGCAACAGCACCCGCACCAGCAGCACCCGCACCCGCACCCTCATCCGCCCTACGTCGAGGACCGGCGTCCCT
CGGCGCCCCCGGGCTACCCGGCGCAGCATCCGCCCCCCCGGCCGCCGCCTCCGTCCCAGACCGCTCCCGCCGCCG
TCGCCCGCCCGGAACCGTCCCCGCCCCAGCCCGGCGCGCACCACCTGCCTCCCCACCCCGTGCCTCAAGTCTCCC
CCCCGACGCCCCAACCCGCCCCGGAGCGCCGGCCGCAGGAGCCCCACCCCCCTCCGCCGCCCGTCGAGCCCAAGA
CGGAGCCCTCGGATCGACCGCAGCCGCCCTTGCTGAACACGGACATGGCCATCAAGAAGATGCCCCAACGCAAGT
CCCACAGCATCTTCACGCCCATCGAGGAGAATCGGTCCATCCTGTCCCGGCACCTGGCGTCCTTCGCTGCCGACA
CGCCGCCCGTCAAGAGCGAGTCTGGCGCTGCGGGGGTGGCCGGCGCCGGCGGCGTTGCGCCACCGTCGCACCGGT
CTCAGTCGCTCGACGCCTCCGCCTCACGCGACGGGGTTCCGACCTCGCCGCAGCTGAAGCGCTCCAGCACGCAGA
GCAGCCTTGACAAGACCCGCAACGCCTCGGTGTCGTCGGGCCCGGACAGCACCTTCACGCCGCCGTCGCGGGCCA
ACAGTCTCAAGGCGGTGGCCGGCGCGCGCCCGAGGGGTCCCCGGCTCACGGTGCAGATACCCGACGGCGCGTCGG
AGCCCGGCAGCGCCACCGGCGAGTCCAACTCGCCGCACAACCCCGCCGTCACCCCGACGCATACTCCGCAGCGGC
ACAACTCGCACTCGTCCGTCGTCCTCCCGCCCCCGTCGCCCTCGGCCTCGGCGCTGCTCTCGGCCGGCGCTTCCG
GTCCGCCCAACCCCTTCGCCCGGCCGCCGCCCCAGCAGAACGTCAACGGCGAGACGCCCGTGTCGGCCCTCCCCT
CGCGCTTCCTCAACCACGAGCTGCTGCACAGCCCCAGCAGCTTCTACCAGGACTGGAGCTTTCGCGGCAGCGACA
ACAACGCCATGCCGAGCCCGCTGAACTTTGCCACCCCGGTCGTCGGCTCCGGTCCGAGCTTCTTGCGGGAGGACC
ACCATGCGGGCTCCTCCGGCAACGTCGCCCACGGGTCCGCGGCCGTCTCCAACGGGGGCGGCGGCGGCGGCGGTC
AGAACATCCTGTCGGGCCCCGCGAAGCGCAAGTCTCCCGACTTTGGCAGCAGCGGGCACGGTGAGGCTCACGCGG
CGCCCAACGAGCCCAAGAGGGTCAAAGTCGAGTACGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail