Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1504
Gene name
LocationContig_1330:2888..4657
Strand-
Gene length (bp)1769
Transcript length (bp)1716
Coding sequence length (bp)1716
Protein length (aa) 572

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16199 Radical_SAM_C Radical_SAM C-terminal domain 8.3E-32 327 406
PF04055 Radical_SAM Radical SAM superfamily 2.3E-17 121 309
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 2.1E-08 427 551

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14023|ELP3_SCHPO Probable elongator complex protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=elp3 PE=3 SV=1 16 562 0.0E+00
sp|Q60LW7|ELP3_CAEBR Probable elongator complex protein 3 OS=Caenorhabditis briggsae GN=elpc-3 PE=3 SV=1 20 566 0.0E+00
sp|Q23651|ELP3_CAEEL Probable elongator complex protein 3 OS=Caenorhabditis elegans GN=elpc-3 PE=3 SV=2 20 566 0.0E+00
sp|Q93ZR1|ELP3_ARATH Elongator complex protein 3 OS=Arabidopsis thaliana GN=HAG3 PE=1 SV=1 12 562 0.0E+00
sp|Q7X7L3|ELP3_ORYSJ Elongator complex protein 3 OS=Oryza sativa subsp. japonica GN=ELP3 PE=2 SV=2 14 562 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14023|ELP3_SCHPO Probable elongator complex protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=elp3 PE=3 SV=1 16 562 0.0E+00
sp|Q60LW7|ELP3_CAEBR Probable elongator complex protein 3 OS=Caenorhabditis briggsae GN=elpc-3 PE=3 SV=1 20 566 0.0E+00
sp|Q23651|ELP3_CAEEL Probable elongator complex protein 3 OS=Caenorhabditis elegans GN=elpc-3 PE=3 SV=2 20 566 0.0E+00
sp|Q93ZR1|ELP3_ARATH Elongator complex protein 3 OS=Arabidopsis thaliana GN=HAG3 PE=1 SV=1 12 562 0.0E+00
sp|Q7X7L3|ELP3_ORYSJ Elongator complex protein 3 OS=Oryza sativa subsp. japonica GN=ELP3 PE=2 SV=2 14 562 0.0E+00
sp|Q1ZXC6|ELP3_DICDI Probable elongator complex protein 3 OS=Dictyostelium discoideum GN=elp3 PE=3 SV=1 8 562 0.0E+00
sp|Q9VQZ6|ELP3_DROME Probable elongator complex protein 3 OS=Drosophila melanogaster GN=Elp3 PE=2 SV=1 6 563 0.0E+00
sp|Q9CZX0|ELP3_MOUSE Elongator complex protein 3 OS=Mus musculus GN=Elp3 PE=1 SV=1 10 562 0.0E+00
sp|Q2KJ61|ELP3_BOVIN Elongator complex protein 3 OS=Bos taurus GN=ELP3 PE=2 SV=2 10 563 0.0E+00
sp|Q9H9T3|ELP3_HUMAN Elongator complex protein 3 OS=Homo sapiens GN=ELP3 PE=1 SV=2 10 562 0.0E+00
sp|Q6NVL5|ELP3_XENTR Elongator complex protein 3 OS=Xenopus tropicalis GN=elp3 PE=2 SV=1 19 563 0.0E+00
sp|Q5ZHS1|ELP3_CHICK Elongator complex protein 3 OS=Gallus gallus GN=ELP3 PE=2 SV=1 20 562 0.0E+00
sp|Q5HZM6|ELP3_XENLA Elongator complex protein 3 OS=Xenopus laevis GN=elp3 PE=2 SV=1 19 563 0.0E+00
sp|Q5RIC0|ELP3_DANRE Elongator complex protein 3 OS=Danio rerio GN=elp3 PE=2 SV=3 11 562 0.0E+00
sp|Q02908|ELP3_YEAST Elongator complex protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELP3 PE=1 SV=1 15 560 0.0E+00
sp|Q58536|Y1136_METJA Uncharacterized protein MJ1136 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1136 PE=3 SV=1 19 563 1.0E-144
sp|Q57910|Y486_METJA Uncharacterized protein MJ0486 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0486 PE=3 SV=1 113 382 9.0E-14
sp|P0ADW6|YHCC_ECOLI Protein YhcC OS=Escherichia coli (strain K12) GN=yhcC PE=3 SV=1 157 390 3.0E-12
sp|P0ADW7|YHCC_ECO57 Uncharacterized protein YhcC OS=Escherichia coli O157:H7 GN=yhcC PE=3 SV=1 157 390 3.0E-12
sp|O35008|YTQA_BACSU Uncharacterized protein YtqA OS=Bacillus subtilis (strain 168) GN=ytqA PE=3 SV=1 230 388 5.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0008080 N-acetyltransferase activity Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0016410 N-acyltransferase activity No
GO:0016407 acetyltransferase activity No
GO:0016740 transferase activity No
GO:0016746 acyltransferase activity No
GO:0005488 binding No
GO:0051540 metal cluster binding No
GO:0003674 molecular_function No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Peroxisomal targeting signal 0.5949 0.5675 0.0267 0.0778 0.5616 0.1006 0.1587 0.327 0.123 0.2369

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1707
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1469
Ophiocordyceps australis map64 (Brazil) OphauB2|6208
Ophiocordyceps camponoti-floridani Ophcf2|03393
Ophiocordyceps camponoti-rufipedis Ophun1|1260
Ophiocordyceps kimflemingae Ophio5|1979
Ophiocordyceps subramaniannii Hirsu2|1504 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1504
MATTTVTAARKKGAELAPESQRFLRCCADVANALIEDHEAAKDGRPSRDINLNSLRAKLAKKHKLANIPPLTAII
AAIPEHYKKYILPRLVAKPIRTSSGIAVVAVMCKPHRCPHIAFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR
AIRARYDPFEQARGRVDQLKSLGHSVDKVEYIIMGGTFMSLPESYREDFIAQLHNALSGYQTSKVDEAVEAGEMS
NIKCVGITIETRPDYCLQPHLSDMLRYGCTRLEVGVQSLYEDVARDTNRGHTVAAVAETFCLAKDAGFKVVSHMM
PDLPNVGMERDLDQFREYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYHNYSPNDLVDLVARILALIPPWTR
IYRVQRDIPMPLVTSGVENGNLRELSLARMKDFGTTCRDVRTREVGVNEVKNKIRPNQIELVRRDYVANGGWETF
LAYEDPKQDILVALLRLRKCTEKYTYREELVGQPSSMIRELHVYGTAVPIHARDPRKFQHQGFGTLLMEEAERIA
REEHGSDKISVISGVGVRSYYRKLGYSLDGPYMSKWLDGRAEDGKV*
Coding >Hirsu2|1504
ATGGCGACGACCACGGTTACCGCGGCCAGGAAGAAGGGCGCTGAGCTCGCGCCCGAGAGCCAGCGCTTCTTGCGG
TGCTGCGCCGATGTCGCCAACGCCCTCATCGAGGACCACGAGGCCGCCAAAGATGGCCGTCCGTCGCGGGATATC
AACCTCAACTCTCTGCGCGCCAAGCTCGCCAAGAAACACAAGCTCGCCAACATCCCCCCCTTGACAGCCATCATC
GCCGCCATCCCGGAGCACTACAAGAAATACATCCTGCCGAGGCTTGTCGCAAAACCCATCAGAACTTCGTCGGGC
ATCGCCGTGGTCGCTGTCATGTGCAAGCCCCATCGATGCCCTCACATCGCCTTTACCGGAAACATCTGCGTCTAC
TGCCCTGGCGGCCCCGACTCCGACTTCGAGTACAGCACGCAGTCCTACACCGGATACGAGCCCACGTCGATGCGA
GCCATCCGCGCGCGCTACGATCCCTTCGAGCAGGCCCGGGGACGGGTGGACCAGCTCAAGTCGCTCGGTCACTCG
GTCGATAAGGTCGAGTACATCATCATGGGAGGGACCTTTATGTCACTGCCTGAGTCGTACCGCGAGGACTTCATC
GCGCAGCTGCACAACGCGCTGAGCGGATACCAAACGTCCAAGGTGGACGAGGCCGTCGAGGCGGGCGAGATGAGC
AACATCAAATGCGTGGGCATTACCATCGAGACGCGGCCGGATTACTGCCTGCAACCCCATCTCTCCGACATGCTC
CGCTACGGCTGCACGAGGCTGGAGGTCGGCGTCCAGTCACTGTACGAGGATGTGGCGCGCGACACCAACCGCGGC
CACACGGTCGCGGCTGTCGCAGAAACGTTCTGCTTGGCCAAGGATGCCGGGTTCAAGGTCGTGAGCCACATGATG
CCGGATCTGCCCAACGTGGGCATGGAGCGCGACCTCGATCAGTTCCGCGAGTACTTTGAGAACCCCGCGTTTAGA
ACCGACGGACTCAAGATCTACCCCACGCTGGTCATTCGCGGGACTGGTCTGTATGAGCTGTGGCGGACGGGGCGC
TACCATAACTACTCGCCAAACGACCTCGTCGACCTGGTGGCGAGGATACTGGCCCTGATCCCGCCTTGGACACGC
ATCTACCGCGTTCAGCGCGATATTCCCATGCCCCTCGTCACGTCGGGGGTCGAGAATGGCAATTTGCGGGAGCTC
TCTCTGGCCAGAATGAAGGACTTCGGAACGACATGCCGGGATGTCCGAACCAGAGAGGTGGGCGTCAACGAGGTC
AAGAACAAGATCAGGCCGAACCAGATCGAGCTCGTCCGCAGAGACTACGTCGCCAACGGTGGCTGGGAGACATTC
CTGGCCTACGAGGACCCCAAGCAGGACATCTTGGTCGCCCTGCTGCGGCTGCGCAAGTGCACGGAAAAGTACACG
TACCGCGAGGAACTCGTCGGCCAGCCGAGCAGCATGATTCGCGAGCTTCACGTGTACGGCACGGCGGTGCCCATC
CACGCGCGCGACCCCCGCAAGTTCCAGCACCAGGGCTTCGGCACACTGCTGATGGAGGAGGCCGAGAGGATAGCG
CGCGAAGAGCACGGCAGCGACAAGATCAGCGTCATTTCCGGAGTTGGCGTGCGAAGCTATTACAGGAAGCTCGGC
TATTCCCTGGATGGCCCGTACATGAGCAAATGGCTCGATGGACGGGCTGAGGATGGGAAGGTATAA
Transcript >Hirsu2|1504
ATGGCGACGACCACGGTTACCGCGGCCAGGAAGAAGGGCGCTGAGCTCGCGCCCGAGAGCCAGCGCTTCTTGCGG
TGCTGCGCCGATGTCGCCAACGCCCTCATCGAGGACCACGAGGCCGCCAAAGATGGCCGTCCGTCGCGGGATATC
AACCTCAACTCTCTGCGCGCCAAGCTCGCCAAGAAACACAAGCTCGCCAACATCCCCCCCTTGACAGCCATCATC
GCCGCCATCCCGGAGCACTACAAGAAATACATCCTGCCGAGGCTTGTCGCAAAACCCATCAGAACTTCGTCGGGC
ATCGCCGTGGTCGCTGTCATGTGCAAGCCCCATCGATGCCCTCACATCGCCTTTACCGGAAACATCTGCGTCTAC
TGCCCTGGCGGCCCCGACTCCGACTTCGAGTACAGCACGCAGTCCTACACCGGATACGAGCCCACGTCGATGCGA
GCCATCCGCGCGCGCTACGATCCCTTCGAGCAGGCCCGGGGACGGGTGGACCAGCTCAAGTCGCTCGGTCACTCG
GTCGATAAGGTCGAGTACATCATCATGGGAGGGACCTTTATGTCACTGCCTGAGTCGTACCGCGAGGACTTCATC
GCGCAGCTGCACAACGCGCTGAGCGGATACCAAACGTCCAAGGTGGACGAGGCCGTCGAGGCGGGCGAGATGAGC
AACATCAAATGCGTGGGCATTACCATCGAGACGCGGCCGGATTACTGCCTGCAACCCCATCTCTCCGACATGCTC
CGCTACGGCTGCACGAGGCTGGAGGTCGGCGTCCAGTCACTGTACGAGGATGTGGCGCGCGACACCAACCGCGGC
CACACGGTCGCGGCTGTCGCAGAAACGTTCTGCTTGGCCAAGGATGCCGGGTTCAAGGTCGTGAGCCACATGATG
CCGGATCTGCCCAACGTGGGCATGGAGCGCGACCTCGATCAGTTCCGCGAGTACTTTGAGAACCCCGCGTTTAGA
ACCGACGGACTCAAGATCTACCCCACGCTGGTCATTCGCGGGACTGGTCTGTATGAGCTGTGGCGGACGGGGCGC
TACCATAACTACTCGCCAAACGACCTCGTCGACCTGGTGGCGAGGATACTGGCCCTGATCCCGCCTTGGACACGC
ATCTACCGCGTTCAGCGCGATATTCCCATGCCCCTCGTCACGTCGGGGGTCGAGAATGGCAATTTGCGGGAGCTC
TCTCTGGCCAGAATGAAGGACTTCGGAACGACATGCCGGGATGTCCGAACCAGAGAGGTGGGCGTCAACGAGGTC
AAGAACAAGATCAGGCCGAACCAGATCGAGCTCGTCCGCAGAGACTACGTCGCCAACGGTGGCTGGGAGACATTC
CTGGCCTACGAGGACCCCAAGCAGGACATCTTGGTCGCCCTGCTGCGGCTGCGCAAGTGCACGGAAAAGTACACG
TACCGCGAGGAACTCGTCGGCCAGCCGAGCAGCATGATTCGCGAGCTTCACGTGTACGGCACGGCGGTGCCCATC
CACGCGCGCGACCCCCGCAAGTTCCAGCACCAGGGCTTCGGCACACTGCTGATGGAGGAGGCCGAGAGGATAGCG
CGCGAAGAGCACGGCAGCGACAAGATCAGCGTCATTTCCGGAGTTGGCGTGCGAAGCTATTACAGGAAGCTCGGC
TATTCCCTGGATGGCCCGTACATGAGCAAATGGCTCGATGGACGGGCTGAGGATGGGAAGGTATAA
Gene >Hirsu2|1504
ATGGCGACGACCACGGTTACCGCGGCCAGGAAGAAGGGCGCTGAGCTCGCGCCCGAGAGCCAGCGCTTCTTGCGG
TGCTGCGCCGATGTCGCCAACGCCCTCATCGAGGACCACGAGGCCGCCAAAGATGGCCGTCCGTCGCGGGATATC
AACCTCAACTCTCTGCGCGCCAAGCTCGCCAAGAAACACAAGCTCGCCAACATCCCCCCCTTGACAGCCATCATC
GCCGCCATCCCGGAGCACTACAAGAAATACATCCTGCCGAGGCTTGTCGCAAAACCCATCAGTATGGTGCCTGTC
CGTCCCGCCGACTCGGCCTTTGTGACTGATGTGGGACAGGAACTTCGTCGGGCATCGCCGTGGTCGCTGTCATGT
GCAAGCCCCATCGATGCCCTCACATCGCCTTTACCGGAAACATCTGCGTCTACTGCCCTGGCGGCCCCGACTCCG
ACTTCGAGTACAGCACGCAGTCCTACACCGGATACGAGCCCACGTCGATGCGAGCCATCCGCGCGCGCTACGATC
CCTTCGAGCAGGCCCGGGGACGGGTGGACCAGCTCAAGTCGCTCGGTCACTCGGTCGATAAGGTCGAGTACATCA
TCATGGGAGGGACCTTTATGTCACTGCCTGAGTCGTACCGCGAGGACTTCATCGCGCAGCTGCACAACGCGCTGA
GCGGATACCAAACGTCCAAGGTGGACGAGGCCGTCGAGGCGGGCGAGATGAGCAACATCAAATGCGTGGGCATTA
CCATCGAGACGCGGCCGGATTACTGCCTGCAACCCCATCTCTCCGACATGCTCCGCTACGGCTGCACGAGGCTGG
AGGTCGGCGTCCAGTCACTGTACGAGGATGTGGCGCGCGACACCAACCGCGGCCACACGGTCGCGGCTGTCGCAG
AAACGTTCTGCTTGGCCAAGGATGCCGGGTTCAAGGTCGTGAGCCACATGATGCCGGATCTGCCCAACGTGGGCA
TGGAGCGCGACCTCGATCAGTTCCGCGAGTACTTTGAGAACCCCGCGTTTAGAACCGACGGACTCAAGATCTACC
CCACGCTGGTCATTCGCGGGACTGGTCTGTATGAGCTGTGGCGGACGGGGCGCTACCATAACTACTCGCCAAACG
ACCTCGTCGACCTGGTGGCGAGGATACTGGCCCTGATCCCGCCTTGGACACGCATCTACCGCGTTCAGCGCGATA
TTCCCATGCCCCTCGTCACGTCGGGGGTCGAGAATGGCAATTTGCGGGAGCTCTCTCTGGCCAGAATGAAGGACT
TCGGAACGACATGCCGGGATGTCCGAACCAGAGAGGTGGGCGTCAACGAGGTCAAGAACAAGATCAGGCCGAACC
AGATCGAGCTCGTCCGCAGAGACTACGTCGCCAACGGTGGCTGGGAGACATTCCTGGCCTACGAGGACCCCAAGC
AGGACATCTTGGTCGCCCTGCTGCGGCTGCGCAAGTGCACGGAAAAGTACACGTACCGCGAGGAACTCGTCGGCC
AGCCGAGCAGCATGATTCGCGAGCTTCACGTGTACGGCACGGCGGTGCCCATCCACGCGCGCGACCCCCGCAAGT
TCCAGCACCAGGGCTTCGGCACACTGCTGATGGAGGAGGCCGAGAGGATAGCGCGCGAAGAGCACGGCAGCGACA
AGATCAGCGTCATTTCCGGAGTTGGCGTGCGAAGCTATTACAGGAAGCTCGGCTATTCCCTGGATGGCCCGTACA
TGAGCAAATGGCTCGATGGACGGGCTGAGGATGGGAAGGTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail