Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1504
Gene name
LocationContig_1330:2888..4657
Strand-
Gene length (bp)1769
Transcript length (bp)1716
Coding sequence length (bp)1716
Protein length (aa) 572

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16199 Radical_SAM_C Radical_SAM C-terminal domain 5.2E-32 327 406
PF04055 Radical_SAM Radical SAM superfamily 2.3E-17 121 309
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 1.9E-08 427 551
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 1.0E-05 507 555

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14023|ELP3_SCHPO Probable elongator complex protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=elp3 PE=3 SV=1 16 562 0.0E+00
sp|Q60LW7|ELP3_CAEBR Probable elongator complex protein 3 OS=Caenorhabditis briggsae GN=elpc-3 PE=3 SV=1 20 566 0.0E+00
sp|Q23651|ELP3_CAEEL Probable elongator complex protein 3 OS=Caenorhabditis elegans GN=elpc-3 PE=3 SV=2 20 566 0.0E+00
sp|Q93ZR1|ELP3_ARATH Elongator complex protein 3 OS=Arabidopsis thaliana GN=HAG3 PE=1 SV=1 12 562 0.0E+00
sp|Q7X7L3|ELP3_ORYSJ Elongator complex protein 3 OS=Oryza sativa subsp. japonica GN=ELP3 PE=2 SV=2 14 562 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14023|ELP3_SCHPO Probable elongator complex protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=elp3 PE=3 SV=1 16 562 0.0E+00
sp|Q60LW7|ELP3_CAEBR Probable elongator complex protein 3 OS=Caenorhabditis briggsae GN=elpc-3 PE=3 SV=1 20 566 0.0E+00
sp|Q23651|ELP3_CAEEL Probable elongator complex protein 3 OS=Caenorhabditis elegans GN=elpc-3 PE=3 SV=2 20 566 0.0E+00
sp|Q93ZR1|ELP3_ARATH Elongator complex protein 3 OS=Arabidopsis thaliana GN=HAG3 PE=1 SV=1 12 562 0.0E+00
sp|Q7X7L3|ELP3_ORYSJ Elongator complex protein 3 OS=Oryza sativa subsp. japonica GN=ELP3 PE=2 SV=2 14 562 0.0E+00
sp|Q1ZXC6|ELP3_DICDI Probable elongator complex protein 3 OS=Dictyostelium discoideum GN=elp3 PE=3 SV=1 8 562 0.0E+00
sp|Q9VQZ6|ELP3_DROME Probable elongator complex protein 3 OS=Drosophila melanogaster GN=Elp3 PE=2 SV=1 6 563 0.0E+00
sp|Q9CZX0|ELP3_MOUSE Elongator complex protein 3 OS=Mus musculus GN=Elp3 PE=1 SV=1 10 562 0.0E+00
sp|Q2KJ61|ELP3_BOVIN Elongator complex protein 3 OS=Bos taurus GN=ELP3 PE=2 SV=2 10 563 0.0E+00
sp|Q9H9T3|ELP3_HUMAN Elongator complex protein 3 OS=Homo sapiens GN=ELP3 PE=1 SV=2 10 562 0.0E+00
sp|Q6NVL5|ELP3_XENTR Elongator complex protein 3 OS=Xenopus tropicalis GN=elp3 PE=2 SV=1 19 563 0.0E+00
sp|Q5ZHS1|ELP3_CHICK Elongator complex protein 3 OS=Gallus gallus GN=ELP3 PE=2 SV=1 20 562 0.0E+00
sp|Q5HZM6|ELP3_XENLA Elongator complex protein 3 OS=Xenopus laevis GN=elp3 PE=2 SV=1 19 563 0.0E+00
sp|Q5RIC0|ELP3_DANRE Elongator complex protein 3 OS=Danio rerio GN=elp3 PE=2 SV=3 11 562 0.0E+00
sp|Q02908|ELP3_YEAST Elongator complex protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELP3 PE=1 SV=1 15 560 0.0E+00
sp|Q58536|Y1136_METJA Uncharacterized protein MJ1136 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1136 PE=3 SV=1 19 563 1.0E-144
sp|Q57910|Y486_METJA Uncharacterized protein MJ0486 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0486 PE=3 SV=1 113 382 9.0E-14
sp|P0ADW6|YHCC_ECOLI Protein YhcC OS=Escherichia coli (strain K12) GN=yhcC PE=3 SV=1 157 390 3.0E-12
sp|P0ADW7|YHCC_ECO57 Uncharacterized protein YhcC OS=Escherichia coli O157:H7 GN=yhcC PE=3 SV=1 157 390 3.0E-12
sp|O35008|YTQA_BACSU Uncharacterized protein YtqA OS=Bacillus subtilis (strain 168) GN=ytqA PE=3 SV=1 230 388 5.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0003824 catalytic activity Yes
GO:0048037 cofactor binding No
GO:0051540 metal cluster binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1504
MATTTVTAARKKGAELAPESQRFLRCCADVANALIEDHEAAKDGRPSRDINLNSLRAKLAKKHKLANIPPLTAII
AAIPEHYKKYILPRLVAKPIRTSSGIAVVAVMCKPHRCPHIAFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMR
AIRARYDPFEQARGRVDQLKSLGHSVDKVEYIIMGGTFMSLPESYREDFIAQLHNALSGYQTSKVDEAVEAGEMS
NIKCVGITIETRPDYCLQPHLSDMLRYGCTRLEVGVQSLYEDVARDTNRGHTVAAVAETFCLAKDAGFKVVSHMM
PDLPNVGMERDLDQFREYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYHNYSPNDLVDLVARILALIPPWTR
IYRVQRDIPMPLVTSGVENGNLRELSLARMKDFGTTCRDVRTREVGVNEVKNKIRPNQIELVRRDYVANGGWETF
LAYEDPKQDILVALLRLRKCTEKYTYREELVGQPSSMIRELHVYGTAVPIHARDPRKFQHQGFGTLLMEEAERIA
REEHGSDKISVISGVGVRSYYRKLGYSLDGPYMSKWLDGRAEDGKV*
Coding >Hirsu2|1504
ATGGCGACGACCACGGTTACCGCGGCCAGGAAGAAGGGCGCTGAGCTCGCGCCCGAGAGCCAGCGCTTCTTGCGG
TGCTGCGCCGATGTCGCCAACGCCCTCATCGAGGACCACGAGGCCGCCAAAGATGGCCGTCCGTCGCGGGATATC
AACCTCAACTCTCTGCGCGCCAAGCTCGCCAAGAAACACAAGCTCGCCAACATCCCCCCCTTGACAGCCATCATC
GCCGCCATCCCGGAGCACTACAAGAAATACATCCTGCCGAGGCTTGTCGCAAAACCCATCAGAACTTCGTCGGGC
ATCGCCGTGGTCGCTGTCATGTGCAAGCCCCATCGATGCCCTCACATCGCCTTTACCGGAAACATCTGCGTCTAC
TGCCCTGGCGGCCCCGACTCCGACTTCGAGTACAGCACGCAGTCCTACACCGGATACGAGCCCACGTCGATGCGA
GCCATCCGCGCGCGCTACGATCCCTTCGAGCAGGCCCGGGGACGGGTGGACCAGCTCAAGTCGCTCGGTCACTCG
GTCGATAAGGTCGAGTACATCATCATGGGAGGGACCTTTATGTCACTGCCTGAGTCGTACCGCGAGGACTTCATC
GCGCAGCTGCACAACGCGCTGAGCGGATACCAAACGTCCAAGGTGGACGAGGCCGTCGAGGCGGGCGAGATGAGC
AACATCAAATGCGTGGGCATTACCATCGAGACGCGGCCGGATTACTGCCTGCAACCCCATCTCTCCGACATGCTC
CGCTACGGCTGCACGAGGCTGGAGGTCGGCGTCCAGTCACTGTACGAGGATGTGGCGCGCGACACCAACCGCGGC
CACACGGTCGCGGCTGTCGCAGAAACGTTCTGCTTGGCCAAGGATGCCGGGTTCAAGGTCGTGAGCCACATGATG
CCGGATCTGCCCAACGTGGGCATGGAGCGCGACCTCGATCAGTTCCGCGAGTACTTTGAGAACCCCGCGTTTAGA
ACCGACGGACTCAAGATCTACCCCACGCTGGTCATTCGCGGGACTGGTCTGTATGAGCTGTGGCGGACGGGGCGC
TACCATAACTACTCGCCAAACGACCTCGTCGACCTGGTGGCGAGGATACTGGCCCTGATCCCGCCTTGGACACGC
ATCTACCGCGTTCAGCGCGATATTCCCATGCCCCTCGTCACGTCGGGGGTCGAGAATGGCAATTTGCGGGAGCTC
TCTCTGGCCAGAATGAAGGACTTCGGAACGACATGCCGGGATGTCCGAACCAGAGAGGTGGGCGTCAACGAGGTC
AAGAACAAGATCAGGCCGAACCAGATCGAGCTCGTCCGCAGAGACTACGTCGCCAACGGTGGCTGGGAGACATTC
CTGGCCTACGAGGACCCCAAGCAGGACATCTTGGTCGCCCTGCTGCGGCTGCGCAAGTGCACGGAAAAGTACACG
TACCGCGAGGAACTCGTCGGCCAGCCGAGCAGCATGATTCGCGAGCTTCACGTGTACGGCACGGCGGTGCCCATC
CACGCGCGCGACCCCCGCAAGTTCCAGCACCAGGGCTTCGGCACACTGCTGATGGAGGAGGCCGAGAGGATAGCG
CGCGAAGAGCACGGCAGCGACAAGATCAGCGTCATTTCCGGAGTTGGCGTGCGAAGCTATTACAGGAAGCTCGGC
TATTCCCTGGATGGCCCGTACATGAGCAAATGGCTCGATGGACGGGCTGAGGATGGGAAGGTATAA
Transcript >Hirsu2|1504
ATGGCGACGACCACGGTTACCGCGGCCAGGAAGAAGGGCGCTGAGCTCGCGCCCGAGAGCCAGCGCTTCTTGCGG
TGCTGCGCCGATGTCGCCAACGCCCTCATCGAGGACCACGAGGCCGCCAAAGATGGCCGTCCGTCGCGGGATATC
AACCTCAACTCTCTGCGCGCCAAGCTCGCCAAGAAACACAAGCTCGCCAACATCCCCCCCTTGACAGCCATCATC
GCCGCCATCCCGGAGCACTACAAGAAATACATCCTGCCGAGGCTTGTCGCAAAACCCATCAGAACTTCGTCGGGC
ATCGCCGTGGTCGCTGTCATGTGCAAGCCCCATCGATGCCCTCACATCGCCTTTACCGGAAACATCTGCGTCTAC
TGCCCTGGCGGCCCCGACTCCGACTTCGAGTACAGCACGCAGTCCTACACCGGATACGAGCCCACGTCGATGCGA
GCCATCCGCGCGCGCTACGATCCCTTCGAGCAGGCCCGGGGACGGGTGGACCAGCTCAAGTCGCTCGGTCACTCG
GTCGATAAGGTCGAGTACATCATCATGGGAGGGACCTTTATGTCACTGCCTGAGTCGTACCGCGAGGACTTCATC
GCGCAGCTGCACAACGCGCTGAGCGGATACCAAACGTCCAAGGTGGACGAGGCCGTCGAGGCGGGCGAGATGAGC
AACATCAAATGCGTGGGCATTACCATCGAGACGCGGCCGGATTACTGCCTGCAACCCCATCTCTCCGACATGCTC
CGCTACGGCTGCACGAGGCTGGAGGTCGGCGTCCAGTCACTGTACGAGGATGTGGCGCGCGACACCAACCGCGGC
CACACGGTCGCGGCTGTCGCAGAAACGTTCTGCTTGGCCAAGGATGCCGGGTTCAAGGTCGTGAGCCACATGATG
CCGGATCTGCCCAACGTGGGCATGGAGCGCGACCTCGATCAGTTCCGCGAGTACTTTGAGAACCCCGCGTTTAGA
ACCGACGGACTCAAGATCTACCCCACGCTGGTCATTCGCGGGACTGGTCTGTATGAGCTGTGGCGGACGGGGCGC
TACCATAACTACTCGCCAAACGACCTCGTCGACCTGGTGGCGAGGATACTGGCCCTGATCCCGCCTTGGACACGC
ATCTACCGCGTTCAGCGCGATATTCCCATGCCCCTCGTCACGTCGGGGGTCGAGAATGGCAATTTGCGGGAGCTC
TCTCTGGCCAGAATGAAGGACTTCGGAACGACATGCCGGGATGTCCGAACCAGAGAGGTGGGCGTCAACGAGGTC
AAGAACAAGATCAGGCCGAACCAGATCGAGCTCGTCCGCAGAGACTACGTCGCCAACGGTGGCTGGGAGACATTC
CTGGCCTACGAGGACCCCAAGCAGGACATCTTGGTCGCCCTGCTGCGGCTGCGCAAGTGCACGGAAAAGTACACG
TACCGCGAGGAACTCGTCGGCCAGCCGAGCAGCATGATTCGCGAGCTTCACGTGTACGGCACGGCGGTGCCCATC
CACGCGCGCGACCCCCGCAAGTTCCAGCACCAGGGCTTCGGCACACTGCTGATGGAGGAGGCCGAGAGGATAGCG
CGCGAAGAGCACGGCAGCGACAAGATCAGCGTCATTTCCGGAGTTGGCGTGCGAAGCTATTACAGGAAGCTCGGC
TATTCCCTGGATGGCCCGTACATGAGCAAATGGCTCGATGGACGGGCTGAGGATGGGAAGGTATAA
Gene >Hirsu2|1504
ATGGCGACGACCACGGTTACCGCGGCCAGGAAGAAGGGCGCTGAGCTCGCGCCCGAGAGCCAGCGCTTCTTGCGG
TGCTGCGCCGATGTCGCCAACGCCCTCATCGAGGACCACGAGGCCGCCAAAGATGGCCGTCCGTCGCGGGATATC
AACCTCAACTCTCTGCGCGCCAAGCTCGCCAAGAAACACAAGCTCGCCAACATCCCCCCCTTGACAGCCATCATC
GCCGCCATCCCGGAGCACTACAAGAAATACATCCTGCCGAGGCTTGTCGCAAAACCCATCAGTATGGTGCCTGTC
CGTCCCGCCGACTCGGCCTTTGTGACTGATGTGGGACAGGAACTTCGTCGGGCATCGCCGTGGTCGCTGTCATGT
GCAAGCCCCATCGATGCCCTCACATCGCCTTTACCGGAAACATCTGCGTCTACTGCCCTGGCGGCCCCGACTCCG
ACTTCGAGTACAGCACGCAGTCCTACACCGGATACGAGCCCACGTCGATGCGAGCCATCCGCGCGCGCTACGATC
CCTTCGAGCAGGCCCGGGGACGGGTGGACCAGCTCAAGTCGCTCGGTCACTCGGTCGATAAGGTCGAGTACATCA
TCATGGGAGGGACCTTTATGTCACTGCCTGAGTCGTACCGCGAGGACTTCATCGCGCAGCTGCACAACGCGCTGA
GCGGATACCAAACGTCCAAGGTGGACGAGGCCGTCGAGGCGGGCGAGATGAGCAACATCAAATGCGTGGGCATTA
CCATCGAGACGCGGCCGGATTACTGCCTGCAACCCCATCTCTCCGACATGCTCCGCTACGGCTGCACGAGGCTGG
AGGTCGGCGTCCAGTCACTGTACGAGGATGTGGCGCGCGACACCAACCGCGGCCACACGGTCGCGGCTGTCGCAG
AAACGTTCTGCTTGGCCAAGGATGCCGGGTTCAAGGTCGTGAGCCACATGATGCCGGATCTGCCCAACGTGGGCA
TGGAGCGCGACCTCGATCAGTTCCGCGAGTACTTTGAGAACCCCGCGTTTAGAACCGACGGACTCAAGATCTACC
CCACGCTGGTCATTCGCGGGACTGGTCTGTATGAGCTGTGGCGGACGGGGCGCTACCATAACTACTCGCCAAACG
ACCTCGTCGACCTGGTGGCGAGGATACTGGCCCTGATCCCGCCTTGGACACGCATCTACCGCGTTCAGCGCGATA
TTCCCATGCCCCTCGTCACGTCGGGGGTCGAGAATGGCAATTTGCGGGAGCTCTCTCTGGCCAGAATGAAGGACT
TCGGAACGACATGCCGGGATGTCCGAACCAGAGAGGTGGGCGTCAACGAGGTCAAGAACAAGATCAGGCCGAACC
AGATCGAGCTCGTCCGCAGAGACTACGTCGCCAACGGTGGCTGGGAGACATTCCTGGCCTACGAGGACCCCAAGC
AGGACATCTTGGTCGCCCTGCTGCGGCTGCGCAAGTGCACGGAAAAGTACACGTACCGCGAGGAACTCGTCGGCC
AGCCGAGCAGCATGATTCGCGAGCTTCACGTGTACGGCACGGCGGTGCCCATCCACGCGCGCGACCCCCGCAAGT
TCCAGCACCAGGGCTTCGGCACACTGCTGATGGAGGAGGCCGAGAGGATAGCGCGCGAAGAGCACGGCAGCGACA
AGATCAGCGTCATTTCCGGAGTTGGCGTGCGAAGCTATTACAGGAAGCTCGGCTATTCCCTGGATGGCCCGTACA
TGAGCAAATGGCTCGATGGACGGGCTGAGGATGGGAAGGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail