Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|150
Gene name
LocationContig_1024:207..1003
Strand-
Gene length (bp)796
Transcript length (bp)732
Coding sequence length (bp)732
Protein length (aa) 244

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2QLK4|FKS1_ASPNC 1,3-beta-glucan synthase component FKS1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fksA PE=3 SV=1 2 227 2.0E-78
sp|P38631|FKS1_YEAST 1,3-beta-glucan synthase component FKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKS1 PE=1 SV=2 2 222 2.0E-62
sp|P40989|FKS2_YEAST 1,3-beta-glucan synthase component GSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSC2 PE=1 SV=2 8 214 3.0E-62
sp|Q10287|BGS1_SCHPO 1,3-beta-glucan synthase component bgs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgs1 PE=1 SV=1 11 193 2.0E-47
sp|Q9P377|BGS3_SCHPO 1,3-beta-glucan synthase component bgs3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgs3 PE=1 SV=1 2 202 3.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2QLK4|FKS1_ASPNC 1,3-beta-glucan synthase component FKS1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fksA PE=3 SV=1 2 227 2.0E-78
sp|P38631|FKS1_YEAST 1,3-beta-glucan synthase component FKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKS1 PE=1 SV=2 2 222 2.0E-62
sp|P40989|FKS2_YEAST 1,3-beta-glucan synthase component GSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSC2 PE=1 SV=2 8 214 3.0E-62
sp|Q10287|BGS1_SCHPO 1,3-beta-glucan synthase component bgs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgs1 PE=1 SV=1 11 193 2.0E-47
sp|Q9P377|BGS3_SCHPO 1,3-beta-glucan synthase component bgs3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgs3 PE=1 SV=1 2 202 3.0E-47
sp|O93927|FKS1_CRYNH 1,3-beta-glucan synthase component FKS1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=FKS1 PE=3 SV=3 1 165 1.0E-46
sp|O13967|BGS2_SCHPO 1,3-beta-glucan synthase component bgs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgs2 PE=2 SV=2 2 207 2.0E-45
sp|O74475|BGS4_SCHPO 1,3-beta-glucan synthase component bgs4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgs4 PE=1 SV=1 6 170 7.0E-45
sp|Q04952|FKS3_YEAST 1,3-beta-glucan synthase component FKS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKS3 PE=1 SV=1 2 201 1.0E-41
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 83 105 22
3 145 167 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|150
MLIFFEAMFVLESFNFARTLAGMIAVVAIQRFIFKLIVSLALTREMKTDQSNVAFWTGKWYSMGWHSMSQPAREF
LCKITELSMFAADFILGHWLLFLMLPVILIPQVDKLHSMMLFWLRPSRQIRPPIYSMKQSKLRRRRVVRYAMLYF
SLLAVFLGLIVGPIVAGRQIPKKVLTGLGSAASLGNKFHLMQPNGQNMDNTNGTEETGTGRPGYTGAFTRSTTRT
GAAEATASGKANNKIKLF*
Coding >Hirsu2|150
ATGCTCATATTCTTCGAGGCCATGTTCGTCCTGGAGAGCTTCAACTTTGCCAGGACGCTGGCTGGCATGATTGCC
GTGGTGGCCATTCAGAGGTTCATCTTTAAGCTGATTGTGTCACTTGCCCTAACACGCGAGATGAAGACAGACCAA
TCAAATGTTGCCTTCTGGACTGGAAAGTGGTATTCCATGGGCTGGCACTCGATGTCGCAGCCTGCTCGCGAGTTT
CTCTGCAAGATCACAGAGCTGAGCATGTTCGCCGCGGATTTCATTCTGGGACACTGGCTACTGTTTCTGATGTTG
CCGGTCATCCTTATCCCCCAGGTCGATAAGCTGCACTCGATGATGCTTTTCTGGCTTCGACCAAGCCGCCAAATA
CGACCGCCAATCTACTCGATGAAGCAGTCGAAACTCCGCCGGAGACGAGTAGTCCGATATGCAATGCTCTATTTC
AGCCTGCTAGCAGTCTTCCTTGGGCTCATCGTTGGGCCTATTGTGGCAGGCCGGCAGATCCCAAAGAAGGTGCTG
ACCGGGCTGGGGTCTGCAGCGTCCCTTGGAAATAAATTTCATCTCATGCAACCGAACGGACAGAACATGGACAAC
ACCAACGGAACTGAAGAAACGGGCACAGGCCGTCCCGGCTACACTGGCGCGTTCACTAGGTCAACAACCAGAACA
GGTGCTGCGGAGGCGACGGCCAGTGGCAAGGCCAATAATAAGATCAAGCTATTTTGA
Transcript >Hirsu2|150
ATGCTCATATTCTTCGAGGCCATGTTCGTCCTGGAGAGCTTCAACTTTGCCAGGACGCTGGCTGGCATGATTGCC
GTGGTGGCCATTCAGAGGTTCATCTTTAAGCTGATTGTGTCACTTGCCCTAACACGCGAGATGAAGACAGACCAA
TCAAATGTTGCCTTCTGGACTGGAAAGTGGTATTCCATGGGCTGGCACTCGATGTCGCAGCCTGCTCGCGAGTTT
CTCTGCAAGATCACAGAGCTGAGCATGTTCGCCGCGGATTTCATTCTGGGACACTGGCTACTGTTTCTGATGTTG
CCGGTCATCCTTATCCCCCAGGTCGATAAGCTGCACTCGATGATGCTTTTCTGGCTTCGACCAAGCCGCCAAATA
CGACCGCCAATCTACTCGATGAAGCAGTCGAAACTCCGCCGGAGACGAGTAGTCCGATATGCAATGCTCTATTTC
AGCCTGCTAGCAGTCTTCCTTGGGCTCATCGTTGGGCCTATTGTGGCAGGCCGGCAGATCCCAAAGAAGGTGCTG
ACCGGGCTGGGGTCTGCAGCGTCCCTTGGAAATAAATTTCATCTCATGCAACCGAACGGACAGAACATGGACAAC
ACCAACGGAACTGAAGAAACGGGCACAGGCCGTCCCGGCTACACTGGCGCGTTCACTAGGTCAACAACCAGAACA
GGTGCTGCGGAGGCGACGGCCAGTGGCAAGGCCAATAATAAGATCAAGCTATTTTGA
Gene >Hirsu2|150
ATGCTCATATTCTTCGAGGCCATGTTCGTCCTGGAGAGCTTCAACTTTGCCAGGACGCTGGCTGGCATGATTGCC
GTGGTGGCCATTCAGAGGTTCATCTTTAAGCTGATTGTGTCACTTGCCCTAACACGCGAGATGAAGACAGACCAA
TCAAATGTTGCCTTCTGGACTGGAAAGTGGTATTCCATGGGCTGGCACTCGATGTCGCAGCCTGCTCGCGAGTTT
CTCTGCAAGATCACAGAGCTGAGCATGTTCGCCGCGGATTTCATTCTGGGACACTGGCTACTGTTTCTGATGTTG
CCGGTCATCCTTATCCCCCAGGTCGATAAGCTGCACTCGATGATGCTTTTCTGGCTTCGACCAAGGTACGTGAGC
CCTTTTTTCAATCCCATTCGGATTTTCTTGCCAAGTGCTAAGGTTGGGCCCCAGCCGCCAAATACGACCGCCAAT
CTACTCGATGAAGCAGTCGAAACTCCGCCGGAGACGAGTAGTCCGATATGCAATGCTCTATTTCAGCCTGCTAGC
AGTCTTCCTTGGGCTCATCGTTGGGCCTATTGTGGCAGGCCGGCAGATCCCAAAGAAGGTGCTGACCGGGCTGGG
GTCTGCAGCGTCCCTTGGAAATAAATTTCATCTCATGCAACCGAACGGACAGAACATGGACAACACCAACGGAAC
TGAAGAAACGGGCACAGGCCGTCCCGGCTACACTGGCGCGTTCACTAGGTCAACAACCAGAACAGGTGCTGCGGA
GGCGACGGCCAGTGGCAAGGCCAATAATAAGATCAAGCTATTTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail