Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1499
Gene name
LocationContig_133:25031..26371
Strand+
Gene length (bp)1340
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 2.2E-110 96 405
PF14543 TAXi_N Xylanase inhibitor N-terminal 7.8E-14 97 251

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01294|CARP_NEUCR Vacuolar protease A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep-4 PE=3 SV=2 1 407 0.0E+00
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 17 407 3.0E-176
sp|D4B385|CARP_ARTBC Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 17 407 8.0E-174
sp|O42630|CARP_ASPFU Vacuolar protease A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep2 PE=2 SV=1 3 407 9.0E-173
sp|C5FS55|CARP_ARTOC Vacuolar protease A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP2 PE=3 SV=1 17 407 2.0E-169
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01294|CARP_NEUCR Vacuolar protease A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep-4 PE=3 SV=2 1 407 0.0E+00
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 17 407 3.0E-176
sp|D4B385|CARP_ARTBC Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 17 407 8.0E-174
sp|O42630|CARP_ASPFU Vacuolar protease A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep2 PE=2 SV=1 3 407 9.0E-173
sp|C5FS55|CARP_ARTOC Vacuolar protease A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP2 PE=3 SV=1 17 407 2.0E-169
sp|P07267|CARP_YEAST Saccharopepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP4 PE=1 SV=1 12 406 6.0E-156
sp|P10977|CARPV_CANAX Vacuolar aspartic protease OS=Candida albicans GN=APR1 PE=3 SV=3 6 407 2.0E-153
sp|Q03168|ASPP_AEDAE Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2 83 406 5.0E-106
sp|P28712|PEPA1_RABIT Pepsin II-1 OS=Oryctolagus cuniculus PE=2 SV=1 15 406 4.0E-96
sp|Q05744|CATD_CHICK Cathepsin D OS=Gallus gallus GN=CTSD PE=1 SV=1 86 404 5.0E-95
sp|Q805F3|CATEA_XENLA Cathepsin E-A OS=Xenopus laevis GN=ctse-a PE=1 SV=1 24 404 2.0E-94
sp|Q805F2|CATEB_XENLA Cathepsin E-B OS=Xenopus laevis GN=ctse-b PE=2 SV=1 24 404 8.0E-94
sp|P28713|PEPA4_RABIT Pepsin II-4 OS=Oryctolagus cuniculus PE=2 SV=1 89 406 9.0E-94
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 57 404 1.0E-93
sp|P14091|CATE_HUMAN Cathepsin E OS=Homo sapiens GN=CTSE PE=1 SV=2 13 406 1.0E-93
sp|P07339|CATD_HUMAN Cathepsin D OS=Homo sapiens GN=CTSD PE=1 SV=1 78 406 2.0E-93
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 88 406 5.0E-93
sp|Q4LAL9|CATD_CANLF Cathepsin D OS=Canis lupus familiaris GN=CTSD PE=2 SV=1 78 406 6.0E-93
sp|P27821|PEPA2_RABIT Pepsin II-2/3 OS=Oryctolagus cuniculus PE=2 SV=1 89 406 7.0E-93
sp|P24268|CATD_RAT Cathepsin D OS=Rattus norvegicus GN=Ctsd PE=1 SV=1 89 406 7.0E-93
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 88 404 9.0E-93
sp|O93428|CATD_CHIHA Cathepsin D OS=Chionodraco hamatus GN=ctsd PE=1 SV=2 86 407 1.0E-92
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 88 406 3.0E-92
sp|P27678|PEPA4_MACFU Pepsin A-4 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=1 88 404 1.0E-91
sp|P27822|PEPA3_RABIT Pepsin-3 OS=Oryctolagus cuniculus PE=2 SV=1 15 406 2.0E-91
sp|Q800A0|CATE_LITCT Cathepsin E OS=Lithobates catesbeiana GN=CTSE PE=1 SV=1 1 404 4.0E-91
sp|P18242|CATD_MOUSE Cathepsin D OS=Mus musculus GN=Ctsd PE=1 SV=1 72 406 7.0E-91
sp|P80209|CATD_BOVIN Cathepsin D OS=Bos taurus GN=CTSD PE=1 SV=2 78 406 8.0E-91
sp|P43159|CATE_RABIT Cathepsin E OS=Oryctolagus cuniculus GN=CTSE PE=2 SV=1 13 406 9.0E-91
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 88 404 1.0E-90
sp|P27677|PEPA2_MACFU Pepsin A-2/A-3 OS=Macaca fuscata fuscata PE=1 SV=1 88 404 4.0E-90
sp|Q9DEX3|CATD_CLUHA Cathepsin D OS=Clupea harengus GN=ctsd PE=1 SV=1 86 404 1.0E-89
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 83 404 1.0E-89
sp|P11489|PEPA_MACMU Pepsin A OS=Macaca mulatta GN=PGA PE=2 SV=1 88 404 2.0E-89
sp|Q9GMY6|PEPA_CANLF Pepsin A OS=Canis lupus familiaris GN=PGA PE=2 SV=1 89 404 3.0E-89
sp|O76856|CATD_DICDI Cathepsin D OS=Dictyostelium discoideum GN=ctsD PE=1 SV=1 87 406 5.0E-89
sp|P03954|PEPA1_MACFU Pepsin A-1 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=2 88 404 5.0E-89
sp|P0DJD8|PEPA3_HUMAN Pepsin A-3 OS=Homo sapiens GN=PGA3 PE=1 SV=1 88 404 1.0E-88
sp|P0DJD7|PEPA4_HUMAN Pepsin A-4 OS=Homo sapiens GN=PGA4 PE=1 SV=1 88 404 1.0E-88
sp|P0DJD9|PEPA5_HUMAN Pepsin A-5 OS=Homo sapiens GN=PGA5 PE=1 SV=1 88 404 2.0E-88
sp|Q9N2D4|PEPA_CALJA Pepsin A OS=Callithrix jacchus GN=PGA PE=1 SV=1 88 404 3.0E-88
sp|P00792|PEPA_BOVIN Pepsin A OS=Bos taurus GN=PGA PE=1 SV=2 88 404 6.0E-88
sp|P16476|PEPE_CHICK Embryonic pepsinogen OS=Gallus gallus PE=2 SV=1 88 406 7.0E-88
sp|Q9MZS8|CATD_SHEEP Cathepsin D (Fragment) OS=Ovis aries GN=CTSD PE=1 SV=1 78 389 1.0E-87
sp|O09043|NAPSA_MOUSE Napsin-A OS=Mus musculus GN=Napsa PE=1 SV=1 87 402 1.0E-87
sp|P25796|CATE_CAVPO Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 23 406 9.0E-86
sp|P55956|ASP3_CAEEL Aspartic protease 3 OS=Caenorhabditis elegans GN=asp-3 PE=1 SV=3 89 407 7.0E-85
sp|O96009|NAPSA_HUMAN Napsin-A OS=Homo sapiens GN=NAPSA PE=1 SV=1 81 407 9.0E-85
sp|P00795|CATD_PIG Cathepsin D OS=Sus scrofa GN=CTSD PE=1 SV=2 86 406 1.0E-84
sp|P08424|RENI_RAT Renin OS=Rattus norvegicus GN=Ren1 PE=2 SV=2 86 407 3.0E-83
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 92 404 2.0E-82
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 92 406 4.0E-82
sp|O65390|APA1_ARATH Aspartic proteinase A1 OS=Arabidopsis thaliana GN=APA1 PE=1 SV=1 58 318 6.0E-82
sp|P06281|RENI1_MOUSE Renin-1 OS=Mus musculus GN=Ren1 PE=1 SV=1 73 407 9.0E-82
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 61 406 2.0E-81
sp|Q6DYE7|RENI_CANLF Renin OS=Canis lupus familiaris GN=REN PE=2 SV=1 86 407 4.0E-81
sp|P00793|PEPA_CHICK Pepsin A OS=Gallus gallus GN=PGA PE=1 SV=1 60 404 5.0E-81
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 47 406 9.0E-81
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 92 406 9.0E-81
sp|P00796|RENI2_MOUSE Renin-2 OS=Mus musculus GN=Ren2 PE=1 SV=1 86 407 9.0E-81
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 61 406 4.0E-80
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 91 406 6.0E-80
sp|Q9TSZ1|RENI_CALJA Renin OS=Callithrix jacchus GN=REN PE=2 SV=1 89 407 1.0E-78
sp|Q9GMY2|PEPC_RABIT Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 91 404 1.0E-78
sp|Q9N2D2|CHYM_CALJA Chymosin OS=Callithrix jacchus GN=CYM PE=1 SV=1 1 406 2.0E-78
sp|P52115|RENI_SHEEP Renin OS=Ovis aries GN=REN PE=2 SV=1 86 407 3.0E-78
sp|Q8VYL3|APA2_ARATH Aspartic proteinase A2 OS=Arabidopsis thaliana GN=APA2 PE=2 SV=1 18 318 2.0E-77
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 92 404 2.0E-77
sp|Q42456|ASPR1_ORYSJ Aspartic proteinase oryzasin-1 OS=Oryza sativa subsp. japonica GN=Os05g0567100 PE=2 SV=2 14 332 3.0E-77
sp|Q28389|PAG_HORSE Pregnancy-associated glycoprotein OS=Equus caballus GN=PAG PE=2 SV=1 88 406 4.0E-77
sp|P40782|CYPR1_CYNCA Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO1 PE=1 SV=2 87 318 6.0E-77
sp|Q689Z7|PEPC_MONDO Gastricsin OS=Monodelphis domestica GN=PGC PE=2 SV=1 70 404 1.0E-76
sp|Q64411|PEPC_CAVPO Gastricsin OS=Cavia porcellus GN=PGC PE=2 SV=1 26 406 2.0E-76
sp|Q9XEC4|APA3_ARATH Aspartic proteinase A3 OS=Arabidopsis thaliana GN=APA3 PE=1 SV=1 1 319 4.0E-76
sp|P60016|RENI_PANTR Renin OS=Pan troglodytes GN=REN PE=3 SV=1 89 407 9.0E-76
sp|P00797|RENI_HUMAN Renin OS=Homo sapiens GN=REN PE=1 SV=1 89 407 9.0E-76
sp|Q29079|PAG2_PIG Pregnancy-associated glycoprotein 2 OS=Sus scrofa GN=PAG2 PE=2 SV=1 88 406 1.0E-75
sp|Q6DLS0|RENI_MACFA Renin OS=Macaca fascicularis GN=REN PE=2 SV=1 89 407 3.0E-75
sp|Q8SQ41|PEPB_CANLF Pepsin B OS=Canis lupus familiaris GN=PGB PE=1 SV=1 61 406 5.0E-75
sp|P27823|PEPAF_RABIT Pepsin F OS=Oryctolagus cuniculus PE=2 SV=1 88 406 6.0E-75
sp|P56272|PEP2B_GADMO Pepsin-2B OS=Gadus morhua PE=1 SV=1 89 406 7.0E-75
sp|Q6DLW5|RENI_MACMU Renin OS=Macaca mulatta GN=REN PE=2 SV=2 89 406 1.0E-74
sp|Q28057|PAG2_BOVIN Pregnancy-associated glycoprotein 2 OS=Bos taurus GN=PAG2 PE=2 SV=1 88 406 6.0E-74
sp|Q29432|PAG1_BOVIN Pregnancy-associated glycoprotein 1 OS=Bos taurus PE=1 SV=1 24 406 3.0E-72
sp|P18276|CHYM_SHEEP Chymosin OS=Ovis aries GN=CYM PE=2 SV=1 87 406 1.0E-71
sp|P00794|CHYM_BOVIN Chymosin OS=Bos taurus GN=CYM PE=1 SV=3 87 406 1.0E-70
sp|P42210|ASPR_HORVU Phytepsin OS=Hordeum vulgare PE=1 SV=1 80 332 3.0E-70
sp|P42211|ASPRX_ORYSJ Aspartic proteinase OS=Oryza sativa subsp. japonica GN=RAP PE=2 SV=2 86 319 5.0E-70
sp|Q9XFX4|CARDB_CYNCA Procardosin-B OS=Cynara cardunculus GN=cardB PE=1 SV=1 83 325 8.0E-69
sp|Q28755|PAG1_SHEEP Pregnancy-associated glycoprotein 1 OS=Ovis aries PE=1 SV=1 59 406 1.0E-68
sp|P83495|PAG4_SHEEP Pregnancy-associated glycoprotein 4 OS=Ovis aries PE=1 SV=2 59 406 2.0E-68
sp|P83493|PAG6_SHEEP Pregnancy-associated glycoprotein 6 OS=Ovis aries PE=1 SV=2 59 406 2.0E-67
sp|Q29078|PAG1_PIG Pregnancy-associated glycoprotein 1 OS=Sus scrofa PE=2 SV=1 87 406 1.0E-61
sp|O04057|ASPR_CUCPE Aspartic proteinase OS=Cucurbita pepo PE=2 SV=1 89 319 2.0E-61
sp|Q9XFX3|CARDA_CYNCA Procardosin-A OS=Cynara cardunculus GN=cardA PE=1 SV=1 79 325 1.0E-60
sp|P85137|CARDF_CYNCA Cardosin-F (Fragments) OS=Cynara cardunculus PE=1 SV=1 83 406 2.0E-54
sp|P46925|PLM2_PLAFA Plasmepsin-2 OS=Plasmodium falciparum PE=1 SV=1 87 407 2.0E-53
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 87 404 6.0E-50
sp|P39898|PLM1_PLAFA Plasmepsin-1 OS=Plasmodium falciparum PE=1 SV=2 77 407 1.0E-49
sp|Q7KQM4|PLM1_PLAF7 Plasmepsin-1 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0076 PE=2 SV=1 77 407 1.0E-49
sp|P85138|CARDG_CYNCA Cardosin-G (Fragments) OS=Cynara cardunculus PE=1 SV=1 83 406 2.0E-47
sp|P85139|CARDH_CYNCA Cardosin-H (Fragments) OS=Cynara cardunculus PE=1 SV=1 83 406 1.0E-46
sp|Q03700|CARP4_RHINI Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 1 395 2.0E-46
sp|O01530|ASP6_CAEEL Aspartic protease 6 OS=Caenorhabditis elegans GN=asp-6 PE=3 SV=1 76 404 2.0E-45
sp|Q03699|CARP3_RHINI Rhizopuspepsin-3 OS=Rhizopus niveus PE=3 SV=1 87 395 6.0E-45
sp|P43232|CARP5_RHINI Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 53 395 9.0E-45
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 87 395 1.0E-43
sp|P81214|CARP_SYNRA Syncephapepsin OS=Syncephalastrum racemosum GN=SPSR PE=1 SV=1 28 407 9.0E-43
sp|P10602|CARP1_RHINI Rhizopuspepsin-1 OS=Rhizopus niveus GN=RNAP PE=1 SV=1 58 395 1.0E-41
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 101 404 2.0E-38
sp|D4AZK1|CTSD_ARTBC Probable aspartic-type endopeptidase CTSD OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CTSD PE=3 SV=1 97 407 1.0E-36
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 97 407 1.0E-36
sp|C4YMJ3|CARP2_CANAW Candidapepsin-2 OS=Candida albicans (strain WO-1) GN=SAP2 PE=1 SV=1 85 407 1.0E-33
sp|C5FEK4|CTSD_ARTOC Probable aspartic-type endopeptidase CTSD (Fragment) OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CTSD PE=3 SV=2 113 407 1.0E-33
sp|P0CS83|CARP2_CANAX Candidapepsin-2 OS=Candida albicans GN=SAP2 PE=1 SV=1 85 407 1.0E-33
sp|P43093|CARP4_CANAW Candidapepsin-4 OS=Candida albicans (strain WO-1) GN=SAP4 PE=3 SV=1 97 407 1.0E-33
sp|Q5A8N2|CARP4_CANAL Candidapepsin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP4 PE=1 SV=1 97 407 2.0E-33
sp|P0DJ06|CARP2_CANAL Candidapepsin-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP2 PE=1 SV=1 85 407 4.0E-33
sp|Q4WNV0|CTSD_ASPFU Aspartic-type endopeptidase ctsD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ctsD PE=1 SV=1 93 404 2.0E-32
sp|P43095|CARP6_CANAX Candidapepsin-6 OS=Candida albicans GN=SAP6 PE=3 SV=1 97 407 3.0E-32
sp|Q5AEM6|CARP8_CANAL Candidapepsin-8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP8 PE=1 SV=1 97 407 4.0E-32
sp|O42778|CARP8_CANAX Candidapepsin-8 OS=Candida albicans GN=SAP8 PE=3 SV=1 97 407 6.0E-32
sp|Q5AC08|CARP6_CANAL Candidapepsin-6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP6 PE=1 SV=1 97 407 1.0E-31
sp|P09177|CARP_RHIPU Mucorpepsin OS=Rhizomucor pusillus PE=1 SV=2 47 404 3.0E-31
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 97 407 2.0E-29
sp|O13340|CARP_PODAS Podosporapepsin OS=Podospora anserina GN=PAPA PE=2 SV=1 87 405 3.0E-29
sp|P85136|CARDE_CYNCA Cardosin-E (Fragments) OS=Cynara cardunculus PE=1 SV=1 89 406 3.0E-29
sp|P43094|CARP5_CANAL Candidapepsin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP5 PE=1 SV=1 97 407 5.0E-28
sp|P32950|CARP2_CANPA Candidapepsin-2 OS=Candida parapsilosis GN=SAPP2 PE=1 SV=1 92 401 7.0E-28
sp|P32951|CARP1_CANPA Candidapepsin-1 OS=Candida parapsilosis GN=SAPP1 PE=1 SV=1 97 407 1.0E-27
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 97 407 3.0E-27
sp|P00799|CARP_RHIMI Mucorpepsin OS=Rhizomucor miehei PE=1 SV=1 96 404 4.0E-27
sp|C4YSF6|CARP1_CANAW Candidapepsin-1 OS=Candida albicans (strain WO-1) GN=SAP1 PE=1 SV=1 78 407 8.0E-27
sp|P0CY27|CARP1_CANAL Candidapepsin-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP1 PE=1 SV=1 78 407 1.0E-26
sp|P0CY26|CARP1_CANAX Candidapepsin-1 OS=Candida albicans GN=SAP1 PE=1 SV=1 78 407 1.0E-26
sp|P0CY28|CARP3_CANAX Candidapepsin-3 OS=Candida albicans GN=SAP3 PE=1 SV=1 85 407 4.0E-26
sp|P0CY29|CARP3_CANAL Candidapepsin-3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP3 PE=1 SV=1 85 407 4.0E-26
sp|C4YNQ5|CARP3_CANAW Candidapepsin-3 OS=Candida albicans (strain WO-1) GN=SAP3 PE=1 SV=1 85 407 4.0E-26
sp|Q4WZS3|Y5950_ASPFU Putative aspergillopepsin A-like aspartic endopeptidase AFUA_2G15950 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G15950 PE=3 SV=2 94 407 1.0E-24
sp|Q00663|CARP_CANTR Candidapepsin OS=Candida tropicalis GN=SAPT1 PE=1 SV=1 79 407 2.0E-23
sp|W8W138|BACE_STRPU Beta-secretase OS=Strongylocentrotus purpuratus GN=BACE PE=2 SV=1 97 321 6.0E-22
sp|Q06902|PEPA_ASPOR Aspartic protease pep1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pep1 PE=1 SV=2 96 404 7.0E-22
sp|B8NLY9|PEPA_ASPFN Aspartic protease pep1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pep1 PE=3 SV=1 96 404 7.0E-22
sp|Q69IF8|PEPA_PHANO Aspartic protease PEP1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PEP1 PE=3 SV=1 23 407 8.0E-22
sp|P54958|ASP2_BLAGE Aspartic protease Bla g 2 OS=Blattella germanica PE=1 SV=1 92 403 1.0E-21
sp|C5FZ57|Y7979_ARTOC Putative aspergillopepsin A-like aspartic endopeptidase MCYG_07979 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_07979 PE=3 SV=1 96 404 3.0E-21
sp|A1DDK1|PEPA_NEOFI Aspartic protease pep1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pep1 PE=3 SV=1 94 404 4.0E-21
sp|C5PEI9|PEPA_COCP7 Aspartic protease PEP3 OS=Coccidioides posadasii (strain C735) GN=PEP3 PE=3 SV=1 88 343 4.0E-21
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 97 404 4.0E-21
sp|P41748|PEPA_ASPFU Aspartic protease pep1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep1 PE=1 SV=2 94 404 5.0E-21
sp|B0Y1V8|PEPA_ASPFC Aspartic protease pep1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pep1 PE=3 SV=1 94 404 5.0E-21
sp|B8MF81|PEPA_TALSN Aspartic protease pep1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=pep1 PE=3 SV=1 94 404 9.0E-21
sp|P00798|PENP_PENJA Penicillopepsin OS=Penicillium janthinellum PE=1 SV=2 88 404 1.0E-20
sp|E5A7T3|PEPA_LEPMJ Aspartic protease PEP1 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=PEP1 PE=3 SV=2 82 404 1.0E-20
sp|P56819|BACE1_RAT Beta-secretase 1 OS=Rattus norvegicus GN=Bace1 PE=2 SV=1 97 406 1.0E-20
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 97 407 2.0E-20
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 97 407 2.0E-20
sp|P11838|CARP_CRYPA Endothiapepsin OS=Cryphonectria parasitica GN=EAPA PE=1 SV=2 7 395 3.0E-20
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 97 407 3.0E-20
sp|O93885|PEPA_EMENI Aspartic protease pep1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pep1 PE=3 SV=1 94 404 3.0E-20
sp|D4DGR1|Y6366_TRIVH Probable aspartic-type endopeptidase TRV_06366 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06366 PE=3 SV=1 94 404 4.0E-20
sp|Q9Y5Z0|BACE2_HUMAN Beta-secretase 2 OS=Homo sapiens GN=BACE2 PE=1 SV=1 97 308 4.0E-20
sp|P56818|BACE1_MOUSE Beta-secretase 1 OS=Mus musculus GN=Bace1 PE=1 SV=2 97 406 4.0E-20
sp|D4AT39|Y7403_ARTBC Probable aspartic-type endopeptidase ARB_07403 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07403 PE=3 SV=2 94 404 6.0E-20
sp|Q6IE75|BACE2_RAT Beta-secretase 2 OS=Rattus norvegicus GN=Bace2 PE=2 SV=1 97 308 7.0E-20
sp|Q2HJ40|BACE1_BOVIN Beta-secretase 1 OS=Bos taurus GN=BACE1 PE=2 SV=1 97 406 1.0E-19
sp|D4DE18|Y5382_TRIVH Probable aspartic-type endopeptidase TRV_05382 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05382 PE=3 SV=1 57 407 1.0E-19
sp|P56817|BACE1_HUMAN Beta-secretase 1 OS=Homo sapiens GN=BACE1 PE=1 SV=2 97 406 1.0E-19
sp|Q9JL18|BACE2_MOUSE Beta-secretase 2 OS=Mus musculus GN=Bace2 PE=2 SV=1 78 308 2.0E-19
sp|Q12567|PEPA_ASPPH Aspartic protease pep1 OS=Aspergillus phoenicis GN=pep1 PE=1 SV=1 94 404 2.0E-19
sp|Q9HEZ3|PEPB_PENJA Aspartic protease pepB OS=Penicillium janthinellum GN=pepB PE=3 SV=1 93 404 3.0E-19
sp|B6HL60|PEPA_PENRW Aspartic protease pep1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=pep1 PE=3 SV=1 94 404 9.0E-19
sp|P17576|CARP_IRPLA Polyporopepsin OS=Irpex lacteus PE=1 SV=1 87 403 1.0E-18
sp|P55325|PEPA_ASPNG Aspartic protease pep1 OS=Aspergillus niger GN=pep1 PE=1 SV=1 94 404 2.0E-18
sp|P32329|YPS1_YEAST Aspartic proteinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS1 PE=1 SV=2 116 407 3.0E-18
sp|A2R3L3|PEPA_ASPNC Aspartic protease pep1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pep1 PE=3 SV=1 94 404 3.0E-18
sp|P12630|BAR1_YEAST Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 97 407 1.0E-17
sp|P78735|PEPA_PENJA Aspartic protease pepA OS=Penicillium janthinellum GN=pepA PE=1 SV=1 94 404 1.0E-17
sp|P17946|PEPA_ASPAW Aspartic protease pep1 OS=Aspergillus awamori GN=pep1 PE=1 SV=1 94 404 2.0E-17
sp|Q1KLR6|BACE1_CAVPO Beta-secretase 1 OS=Cavia porcellus GN=BACE1 PE=2 SV=1 97 406 3.0E-17
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 97 397 6.0E-17
sp|Q01972|PEPA_PENRO Aspartic protease pep1 OS=Penicillium roqueforti GN=pep1 PE=2 SV=1 94 394 3.0E-16
sp|Q92389|AXP1_YARLI Acid extracellular protease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AXP1 PE=3 SV=1 97 406 5.0E-16
sp|Q5A651|CAR10_CANAL Candidapepsin-10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP10 PE=1 SV=1 86 404 8.0E-16
sp|Q59VH7|CARP7_CANAL Candidapepsin-7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP7 PE=1 SV=1 97 406 2.0E-15
sp|D4D7C5|PEPA_TRIVH Aspartic endopeptidase PEP1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP1 PE=3 SV=1 94 404 1.0E-14
sp|P32834|SXA1_SCHPO Aspartic proteinase sxa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sxa1 PE=3 SV=2 97 404 2.0E-14
sp|D4ANC3|PEPA_ARTBC Aspartic protease PEP1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP1 PE=3 SV=1 94 404 4.0E-14
sp|P53379|MKC7_YEAST Aspartic proteinase MKC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKC7 PE=1 SV=2 98 407 1.0E-13
sp|P40583|YPS6_YEAST Aspartic proteinase yapsin-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS6 PE=1 SV=1 97 406 2.0E-13
sp|C5FW52|Y6955_ARTOC Probable aspartic-type endopeptidase MCYG_06955 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_06955 PE=3 SV=1 94 407 5.0E-13
sp|Q8VYL3|APA2_ARATH Aspartic proteinase A2 OS=Arabidopsis thaliana GN=APA2 PE=2 SV=1 302 406 1.0E-12
sp|A1CBR4|PEPA_ASPCL Aspartic protease pep1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pep1 PE=3 SV=1 94 404 1.0E-12
sp|P43096|CARP7_CANAX Candidapepsin-7 OS=Candida albicans GN=SAP7 PE=3 SV=1 97 406 2.0E-12
sp|P42210|ASPR_HORVU Phytepsin OS=Hordeum vulgare PE=1 SV=1 308 406 6.0E-12
sp|O42779|CARP9_CANAX Candidapepsin-9 OS=Candida albicans GN=SAP9 PE=3 SV=1 132 404 6.0E-12
sp|Q42456|ASPR1_ORYSJ Aspartic proteinase oryzasin-1 OS=Oryza sativa subsp. japonica GN=Os05g0567100 PE=2 SV=2 324 404 7.0E-12
sp|Q59SU1|CARP9_CANAL Candidapepsin-9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP9 PE=1 SV=1 126 404 7.0E-12
sp|E5R1B9|PEPA_ARTGP Aspartic protease PEP1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=PEP1 PE=3 SV=1 81 404 2.0E-11
sp|P42211|ASPRX_ORYSJ Aspartic proteinase OS=Oryza sativa subsp. japonica GN=RAP PE=2 SV=2 323 404 1.0E-10
sp|O04057|ASPR_CUCPE Aspartic proteinase OS=Cucurbita pepo PE=2 SV=1 307 406 3.0E-10
sp|D4AIC4|Y4018_ARTBC Probable aspartic-type endopeptidase ARB_04018 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04018 PE=3 SV=1 94 407 3.0E-10
sp|Q9XEC4|APA3_ARATH Aspartic proteinase A3 OS=Arabidopsis thaliana GN=APA3 PE=1 SV=1 323 406 8.0E-10
sp|Q9XFX3|CARDA_CYNCA Procardosin-A OS=Cynara cardunculus GN=cardA PE=1 SV=1 325 406 2.0E-09
sp|P40782|CYPR1_CYNCA Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO1 PE=1 SV=2 324 406 3.0E-09
sp|O65390|APA1_ARATH Aspartic proteinase A1 OS=Arabidopsis thaliana GN=APA1 PE=1 SV=1 302 406 1.0E-08
sp|Q9LS40|ASPG1_ARATH Protein ASPARTIC PROTEASE IN GUARD CELL 1 OS=Arabidopsis thaliana GN=ASPG1 PE=1 SV=1 94 404 2.0E-07
sp|Q9XFX4|CARDB_CYNCA Procardosin-B OS=Cynara cardunculus GN=cardB PE=1 SV=1 302 406 7.0E-07
sp|Q9LX20|ASPL1_ARATH Aspartic proteinase-like protein 1 OS=Arabidopsis thaliana GN=At5g10080 PE=1 SV=1 79 407 1.0E-06
sp|Q766C2|NEP2_NEPGR Aspartic proteinase nepenthesin-2 OS=Nepenthes gracilis GN=nep2 PE=1 SV=1 94 316 5.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1277 0.0251 0.8541 0.1142 0.1245 0.165 0.1598 0.3388 0.1409 0.0022

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999352

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4915
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1883
Ophiocordyceps australis map64 (Brazil) OphauB2|7623
Ophiocordyceps camponoti-floridani Ophcf2|00555
Ophiocordyceps camponoti-rufipedis Ophun1|5046
Ophiocordyceps subramaniannii Hirsu2|1499 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1499
MKTALVVAAALAGSAQAGVHKMSLKKVPLHKQLAASSFEDQAKHLYQKYSGAHAEAWSQKVLGSRLKSHADYMFD
SPPVQAEGDHPLPVSNFMNAQYFSEISIGTPPQTFKVVLDTGSSNLWVPSSSCTSIACFLHTKYDSSASSTFKKN
GSSFEIHYGSGSLTGFVSNDVVKVGDLTIKNQDFAEATTEPGLAFAFGRFDGILGLGYDTISVNHITPPFNQMVK
QKLLDEPVFAFYLSSQEEGSEAIFGGIDKAHFQGDLTWIPLRRKGYWEVDLGSISLGEDELQFDKAGAVLDTGTS
LNVLPTNIAEMMNAQIGAKKSWNGQYTVDCATRDKLPDVTFSLSGHKYSLSAKEYILELQGTCVSSFQGMDFPAR
IGEIVILGDAFLRKYYSAYHLGKNAVGLALAK*
Coding >Hirsu2|1499
ATGAAGACCGCCCTCGTCGTCGCGGCCGCCCTCGCGGGCTCCGCACAGGCCGGCGTCCACAAGATGAGCCTGAAG
AAGGTCCCCCTCCACAAGCAACTGGCTGCTTCTTCGTTCGAGGACCAGGCCAAGCACCTCTACCAAAAGTACTCA
GGCGCCCACGCCGAGGCATGGTCCCAGAAGGTCTTGGGCTCTCGCCTCAAGTCCCACGCCGACTACATGTTTGAT
TCGCCGCCAGTCCAGGCCGAGGGAGATCATCCGCTTCCCGTCTCCAACTTCATGAACGCGCAGTACTTCTCCGAG
ATCAGCATCGGCACGCCGCCCCAGACTTTCAAGGTCGTCCTCGACACCGGCAGCTCCAACCTCTGGGTGCCGTCG
TCGTCTTGCACCAGCATAGCCTGTTTCCTGCACACCAAGTACGATTCGAGCGCCTCGTCAACGTTCAAGAAGAAC
GGCTCCAGCTTCGAGATCCACTACGGCTCCGGCAGCCTCACGGGTTTCGTGTCCAACGACGTCGTCAAGGTCGGC
GACCTCACCATCAAGAACCAGGACTTCGCCGAGGCCACCACGGAGCCCGGCCTCGCCTTCGCCTTCGGCCGCTTT
GACGGCATCCTCGGCCTCGGCTACGACACCATCTCCGTCAACCACATCACCCCGCCCTTCAACCAGATGGTCAAG
CAGAAGCTGCTGGACGAACCCGTCTTCGCCTTCTACCTCTCCAGCCAGGAGGAAGGCAGCGAAGCCATCTTCGGC
GGCATCGACAAGGCCCACTTCCAGGGAGACCTCACCTGGATCCCCCTCCGCCGCAAGGGTTACTGGGAGGTCGAT
CTCGGTTCCATCTCCCTCGGCGAGGACGAGCTCCAGTTCGACAAGGCCGGCGCCGTCCTGGACACGGGCACTTCG
CTCAATGTGCTCCCCACCAACATTGCCGAAATGATGAACGCGCAGATTGGTGCCAAGAAGAGCTGGAACGGGCAG
TACACCGTCGACTGTGCCACGCGCGACAAGCTGCCCGACGTCACCTTCTCCCTCTCCGGCCACAAGTACTCGCTG
TCCGCCAAGGAGTACATCCTCGAGCTCCAGGGGACCTGTGTCTCCTCCTTCCAGGGCATGGACTTCCCTGCGCGG
ATTGGCGAGATTGTCATTCTGGGAGACGCGTTCCTCAGGAAGTACTACTCTGCCTACCACCTGGGCAAGAACGCT
GTTGGATTGGCACTGGCCAAGTAG
Transcript >Hirsu2|1499
ATGAAGACCGCCCTCGTCGTCGCGGCCGCCCTCGCGGGCTCCGCACAGGCCGGCGTCCACAAGATGAGCCTGAAG
AAGGTCCCCCTCCACAAGCAACTGGCTGCTTCTTCGTTCGAGGACCAGGCCAAGCACCTCTACCAAAAGTACTCA
GGCGCCCACGCCGAGGCATGGTCCCAGAAGGTCTTGGGCTCTCGCCTCAAGTCCCACGCCGACTACATGTTTGAT
TCGCCGCCAGTCCAGGCCGAGGGAGATCATCCGCTTCCCGTCTCCAACTTCATGAACGCGCAGTACTTCTCCGAG
ATCAGCATCGGCACGCCGCCCCAGACTTTCAAGGTCGTCCTCGACACCGGCAGCTCCAACCTCTGGGTGCCGTCG
TCGTCTTGCACCAGCATAGCCTGTTTCCTGCACACCAAGTACGATTCGAGCGCCTCGTCAACGTTCAAGAAGAAC
GGCTCCAGCTTCGAGATCCACTACGGCTCCGGCAGCCTCACGGGTTTCGTGTCCAACGACGTCGTCAAGGTCGGC
GACCTCACCATCAAGAACCAGGACTTCGCCGAGGCCACCACGGAGCCCGGCCTCGCCTTCGCCTTCGGCCGCTTT
GACGGCATCCTCGGCCTCGGCTACGACACCATCTCCGTCAACCACATCACCCCGCCCTTCAACCAGATGGTCAAG
CAGAAGCTGCTGGACGAACCCGTCTTCGCCTTCTACCTCTCCAGCCAGGAGGAAGGCAGCGAAGCCATCTTCGGC
GGCATCGACAAGGCCCACTTCCAGGGAGACCTCACCTGGATCCCCCTCCGCCGCAAGGGTTACTGGGAGGTCGAT
CTCGGTTCCATCTCCCTCGGCGAGGACGAGCTCCAGTTCGACAAGGCCGGCGCCGTCCTGGACACGGGCACTTCG
CTCAATGTGCTCCCCACCAACATTGCCGAAATGATGAACGCGCAGATTGGTGCCAAGAAGAGCTGGAACGGGCAG
TACACCGTCGACTGTGCCACGCGCGACAAGCTGCCCGACGTCACCTTCTCCCTCTCCGGCCACAAGTACTCGCTG
TCCGCCAAGGAGTACATCCTCGAGCTCCAGGGGACCTGTGTCTCCTCCTTCCAGGGCATGGACTTCCCTGCGCGG
ATTGGCGAGATTGTCATTCTGGGAGACGCGTTCCTCAGGAAGTACTACTCTGCCTACCACCTGGGCAAGAACGCT
GTTGGATTGGCACTGGCCAAGTAG
Gene >Hirsu2|1499
ATGAAGACCGCCCTCGTCGTCGCGGCCGCCCTCGCGGGCTCCGCACAGGCCGGCGTCCACAAGATGAGCCTGAAG
AAGGTCCCCCTCCACAAGCAACTGGTGAGTCGCCGAGAAACGGTACCGTGGCCCGGCCTTCGCATGCTGACGCCG
TCGCCTGCAGGCTGCTTCTTCGTTCGAGGACCAGGCCAAGCACCTCTACCAAAAGTACTCAGGCGCCCACGCCGA
GGCATGGTCCCAGAAGGTCTTGGGCTCTCGCCTCAAGTCCCACGCCGACTACATGTTTGATTCGCCGCCAGTCCA
GGCCGAGGGAGATCATCCGCTTCCCGTCTCCAACTTCATGAACGCGCAGTGTACGACTCCTCTCGTCTTGTGCCC
TCGAGCATGTGCTGACTCGACCGTCACTAGACTTCTCCGAGATCAGCATCGGCACGCCGCCCCAGACTTTCAAGG
TCGTCCTCGACACCGGCAGCTCCAACCTCTGGGTGCCGTCGTCGTCTTGCACCAGCATAGCCTGTTTCCTGCACA
CCAAGTACGATTCGAGCGCCTCGTCAACGTTCAAGAAGAACGGCTCCAGCTTCGAGATCCACTACGGCTCCGGCA
GCCTCACGGGTTTCGTGTCCAACGACGTCGTCAAGGTCGGCGACCTCACCATCAAGAACCAGGACTTCGCCGAGG
CCACCACGGAGCCCGGCCTCGCCTTCGCCTTCGGCCGCTTTGACGGCATCCTCGGCCTCGGCTACGACACCATCT
CCGTCAACCACATCACCCCGCCCTTCAACCAGATGGTCAAGCAGAAGCTGCTGGACGAACCCGTCTTCGCCTTCT
ACCTCTCCAGCCAGGAGGAAGGCAGCGAAGCCATCTTCGGCGGCATCGACAAGGCCCACTTCCAGGGAGACCTCA
CCTGGATCCCCCTCCGCCGCAAGGGTTACTGGGAGGTCGATCTCGGTTCCATCTCCCTCGGCGAGGACGAGCTCC
AGTTCGACAAGGCCGGCGCCGTCCTGGACACGGGCACTTCGCTCAATGTGCTCCCCACCAACATTGCCGAAATGA
TGAACGCGCAGATTGGTGCCAAGAAGAGCTGGAACGGGCAGTACACCGTCGACTGTGCCACGCGCGACAAGCTGC
CCGACGTCACCTTCTCCCTCTCCGGCCACAAGTACTCGCTGTCCGCCAAGGAGTACATCCTCGAGCTCCAGGGGA
CCTGTGTCTCCTCCTTCCAGGGCATGGACTTCCCTGCGCGGATTGGCGAGATTGTCATTCTGGGAGACGCGTTCC
TCAGGAAGTACTACTCTGCCTACCACCTGGGCAAGAACGCTGTTGGATTGGCACTGGCCAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail