Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1493
Gene name
LocationContig_133:6005..7611
Strand+
Gene length (bp)1606
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10021 DUF2263 Uncharacterized protein conserved in bacteria (DUF2263) 1.0E-07 212 279

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5217 0.2215 0.3174 0.1477 0.338 0.1605 0.1492 0.2027 0.5036 0.0215

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1701
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1879
Ophiocordyceps australis map64 (Brazil) OphauB2|7627
Ophiocordyceps camponoti-floridani Ophcf2|00561
Ophiocordyceps camponoti-rufipedis Ophun1|1368
Ophiocordyceps kimflemingae Ophio5|1089
Ophiocordyceps subramaniannii Hirsu2|1493 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1493
MSAGDAPAATAVERLSVATAIIGLLAVGGKIMEKIWDLNLPSTKHTPALTQALHQVKQCRSTVHILYKTFCRLEA
ARLPFPERAAWIAVDDLIATLADTVLAFSDLQIICDALERQRLEPSGAAASAPGYDDRLGALCSRMRWQSLSMTI
MMTILKCPGAADAEYARVGLERRMTRILTSNTALAQRMRLLEGAVDSRASEAAGGPPRVRIPFICAANERRPGGD
WETGCAGYEEKLCRRSNLSATLSSPWPGVAAASASHYPIPSTGGILSDSVVVCRGPHDRYEKLERWFDLPVVSVP
PTRWPKLKDNGSRYSFAEERDMMREKMRGALRICLYNNYDRVVIGDFGLGNSCRNPPQEVAEIWRDVFLFDPDLR
GQFAYVIFAFEDPAQSTTRLILDEIAKKDKKGGAAKGRSSRDGAAASPSSAPSRTYAPTDLSVFQCVFDAGEIQK
VLSAPDPRYGLDMITS*
Coding >Hirsu2|1493
ATGAGCGCCGGCGACGCGCCCGCCGCGACGGCCGTCGAGAGGCTCTCGGTCGCGACGGCCATCATCGGCCTCCTC
GCCGTCGGCGGCAAGATCATGGAGAAGATCTGGGACCTGAATCTGCCCTCGACCAAGCACACGCCCGCCCTGACC
CAGGCGCTGCACCAGGTCAAGCAGTGTCGCTCCACCGTCCACATCCTCTACAAGACCTTCTGTCGCCTCGAGGCC
GCCCGTCTGCCGTTCCCCGAGCGCGCCGCCTGGATCGCTGTCGACGACCTCATCGCCACCTTGGCCGACACCGTG
CTGGCCTTCTCCGACCTGCAGATCATCTGCGACGCGCTCGAGCGGCAGCGGCTGGAGCCGAGCGGCGCCGCGGCC
TCTGCGCCCGGCTACGACGACCGACTCGGCGCCTTGTGTTCCAGGATGCGCTGGCAATCCCTCTCCATGACTATC
ATGATGACTATTCTCAAGTGCCCGGGCGCCGCCGATGCCGAATATGCCCGAGTCGGGCTCGAGCGACGGATGACG
AGGATCCTGACGTCCAACACGGCGCTGGCGCAGAGAATGCGCCTGCTCGAGGGCGCCGTCGACAGCCGGGCCAGC
GAGGCGGCGGGCGGCCCGCCGCGGGTGCGCATCCCCTTCATCTGCGCCGCCAACGAGCGGCGCCCCGGCGGCGAC
TGGGAGACGGGCTGCGCCGGCTACGAGGAGAAGCTGTGCCGGCGGAGCAACCTGTCGGCGACGCTGAGCAGCCCG
TGGCCCGGCGTGGCGGCGGCCTCGGCGTCGCACTACCCGATCCCGTCGACGGGCGGCATCCTGTCCGACTCGGTC
GTCGTCTGCCGCGGGCCGCACGACCGGTACGAGAAGCTGGAGCGGTGGTTCGACCTGCCGGTCGTGTCGGTGCCG
CCGACGCGCTGGCCCAAGCTCAAGGACAACGGGTCGCGCTACTCGTTCGCCGAGGAGCGCGACATGATGCGCGAG
AAGATGCGCGGCGCGCTGCGCATCTGCCTCTACAACAACTACGACCGCGTCGTCATCGGCGACTTCGGCCTCGGC
AACAGCTGCCGCAACCCGCCGCAGGAGGTGGCCGAGATCTGGCGCGACGTCTTCCTCTTCGACCCGGACCTGCGC
GGCCAGTTCGCCTACGTCATCTTCGCCTTCGAGGACCCGGCCCAGAGCACGACCCGGCTGATCCTCGACGAGATC
GCCAAGAAGGACAAGAAGGGCGGCGCCGCCAAGGGCCGCTCCTCGCGCGACGGGGCCGCCGCCTCGCCCTCGTCC
GCCCCGAGCCGCACCTACGCCCCGACCGACCTCAGCGTCTTCCAGTGCGTCTTCGACGCCGGCGAGATCCAGAAG
GTCCTCAGCGCCCCGGACCCGCGCTACGGCCTCGACATGATCACCTCGTGA
Transcript >Hirsu2|1493
ATGAGCGCCGGCGACGCGCCCGCCGCGACGGCCGTCGAGAGGCTCTCGGTCGCGACGGCCATCATCGGCCTCCTC
GCCGTCGGCGGCAAGATCATGGAGAAGATCTGGGACCTGAATCTGCCCTCGACCAAGCACACGCCCGCCCTGACC
CAGGCGCTGCACCAGGTCAAGCAGTGTCGCTCCACCGTCCACATCCTCTACAAGACCTTCTGTCGCCTCGAGGCC
GCCCGTCTGCCGTTCCCCGAGCGCGCCGCCTGGATCGCTGTCGACGACCTCATCGCCACCTTGGCCGACACCGTG
CTGGCCTTCTCCGACCTGCAGATCATCTGCGACGCGCTCGAGCGGCAGCGGCTGGAGCCGAGCGGCGCCGCGGCC
TCTGCGCCCGGCTACGACGACCGACTCGGCGCCTTGTGTTCCAGGATGCGCTGGCAATCCCTCTCCATGACTATC
ATGATGACTATTCTCAAGTGCCCGGGCGCCGCCGATGCCGAATATGCCCGAGTCGGGCTCGAGCGACGGATGACG
AGGATCCTGACGTCCAACACGGCGCTGGCGCAGAGAATGCGCCTGCTCGAGGGCGCCGTCGACAGCCGGGCCAGC
GAGGCGGCGGGCGGCCCGCCGCGGGTGCGCATCCCCTTCATCTGCGCCGCCAACGAGCGGCGCCCCGGCGGCGAC
TGGGAGACGGGCTGCGCCGGCTACGAGGAGAAGCTGTGCCGGCGGAGCAACCTGTCGGCGACGCTGAGCAGCCCG
TGGCCCGGCGTGGCGGCGGCCTCGGCGTCGCACTACCCGATCCCGTCGACGGGCGGCATCCTGTCCGACTCGGTC
GTCGTCTGCCGCGGGCCGCACGACCGGTACGAGAAGCTGGAGCGGTGGTTCGACCTGCCGGTCGTGTCGGTGCCG
CCGACGCGCTGGCCCAAGCTCAAGGACAACGGGTCGCGCTACTCGTTCGCCGAGGAGCGCGACATGATGCGCGAG
AAGATGCGCGGCGCGCTGCGCATCTGCCTCTACAACAACTACGACCGCGTCGTCATCGGCGACTTCGGCCTCGGC
AACAGCTGCCGCAACCCGCCGCAGGAGGTGGCCGAGATCTGGCGCGACGTCTTCCTCTTCGACCCGGACCTGCGC
GGCCAGTTCGCCTACGTCATCTTCGCCTTCGAGGACCCGGCCCAGAGCACGACCCGGCTGATCCTCGACGAGATC
GCCAAGAAGGACAAGAAGGGCGGCGCCGCCAAGGGCCGCTCCTCGCGCGACGGGGCCGCCGCCTCGCCCTCGTCC
GCCCCGAGCCGCACCTACGCCCCGACCGACCTCAGCGTCTTCCAGTGCGTCTTCGACGCCGGCGAGATCCAGAAG
GTCCTCAGCGCCCCGGACCCGCGCTACGGCCTCGACATGATCACCTCGTGA
Gene >Hirsu2|1493
ATGAGCGCCGGCGACGCGCCCGCCGCGACGGCCGTCGAGAGGCTCTCGGTCGCGACGGCCATCATCGGCCTCCTC
GCCGTCGGCGGCAAGATCATGGAGAAGATCTGGGACCTGAATCTGCCCTCGACCAAGCACACGCCCGCCCTGACC
CAGGCGCTGCACCAGGTCAAGCAGTGTCGCTCCACCGTCCACATCCTCTACAAGACCTTCTGTCGCCTCGAGGCC
GCCCGTCTGCCGTTCCCCGAGCGCGCCGCCTGGATCGCTGTCGACGACCTCATCGCCACCTTGGCCGACACCGTG
CTGGCCTTCTCCGACCTGCAGATCATCTGCGACGCGCTCGAGCGGCAGCGGCTGGAGCCGAGCGGCGCCGCGGCC
TCTGCGCCCGGCTACGACGACCGACTCGGCGCCTTGTGTTCCAGGATGCGCTGGCAATCCCTCTCCATGACTATC
ATGATGACTATTCTCAAGTGGTGAGTCTTTTCGCCGCGATTCCCCTCTCCCCGGTCGGATGGCGCATGTACGATG
CGCGGCCGAGTCGCAAAGCCGGGAGGCTGTAAGACAGGGAACGAGGCGGGATGGGCCGGACAGTGAGGCCGCGGA
GGCGTCTCGAGACGGGCGAAGCGAACTGCGCGGAGACGTGGCGAGTATAACCATCTGACTTTTGTCCGCTCTCAG
CCCGGGCGCCGCCGATGCCGAATATGCCCGAGTCGGGCTCGAGCGACGGATGACGAGGATCCTGACGTCCAACAC
GGCGCTGGCGCAGAGAATGCGCCTGCTCGAGGGCGCCGTCGACAGCCGGGCCAGCGAGGCGGCGGGCGGCCCGCC
GCGGGTGCGCATCCCCTTCATCTGCGCCGCCAACGAGCGGCGCCCCGGCGGCGACTGGGAGACGGGCTGCGCCGG
CTACGAGGAGAAGCTGTGCCGGCGGAGCAACCTGTCGGCGACGCTGAGCAGCCCGTGGCCCGGCGTGGCGGCGGC
CTCGGCGTCGCACTACCCGATCCCGTCGACGGGCGGCATCCTGTCCGACTCGGTCGTCGTCTGCCGCGGGCCGCA
CGACCGGTACGAGAAGCTGGAGCGGTGGTTCGACCTGCCGGTCGTGTCGGTGCCGCCGACGCGCTGGCCCAAGCT
CAAGGACAACGGGTCGCGCTACTCGTTCGCCGAGGAGCGCGACATGATGCGCGAGAAGATGCGCGGCGCGCTGCG
CATCTGCCTCTACAACAACTACGACCGCGTCGTCATCGGCGACTTCGGCCTCGGCAACAGCTGCCGCAACCCGCC
GCAGGAGGTGGCCGAGATCTGGCGCGACGTCTTCCTCTTCGACCCGGACCTGCGCGGCCAGTTCGCCTACGTCAT
CTTCGCCTTCGAGGACCCGGCCCAGAGCACGACCCGGCTGATCCTCGACGAGATCGCCAAGAAGGACAAGAAGGG
CGGCGCCGCCAAGGGCCGCTCCTCGCGCGACGGGGCCGCCGCCTCGCCCTCGTCCGCCCCGAGCCGCACCTACGC
CCCGACCGACCTCAGCGTCTTCCAGTGCGTCTTCGACGCCGGCGAGATCCAGAAGGTCCTCAGCGCCCCGGACCC
GCGCTACGGCCTCGACATGATCACCTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail