Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1490
Gene name
LocationContig_1329:5809..7294
Strand+
Gene length (bp)1485
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03473 MOSC MOSC domain 1.0E-25 62 177
PF03475 3-alpha 3-alpha domain 2.0E-08 186 227
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 2.4E-05 356 444

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O34542|YFLK_BACSU Uncharacterized protein YflK OS=Bacillus subtilis (strain 168) GN=yflK PE=3 SV=1 32 225 5.0E-32
sp|P32157|YIIM_ECOLI Protein YiiM OS=Escherichia coli (strain K12) GN=yiiM PE=1 SV=2 37 181 9.0E-30
sp|P43976|Y278_HAEIN Uncharacterized protein HI_0278 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0278 PE=3 SV=2 19 227 3.0E-27
sp|P76254|YEAX_ECOLI Putative dioxygenase subunit beta YeaX OS=Escherichia coli (strain K12) GN=yeaX PE=3 SV=1 277 444 7.0E-24
sp|Q52186|POBB_PSEPS Phenoxybenzoate dioxygenase subunit beta OS=Pseudomonas pseudoalcaligenes GN=pobB PE=2 SV=1 277 447 5.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O34542|YFLK_BACSU Uncharacterized protein YflK OS=Bacillus subtilis (strain 168) GN=yflK PE=3 SV=1 32 225 5.0E-32
sp|P32157|YIIM_ECOLI Protein YiiM OS=Escherichia coli (strain K12) GN=yiiM PE=1 SV=2 37 181 9.0E-30
sp|P43976|Y278_HAEIN Uncharacterized protein HI_0278 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0278 PE=3 SV=2 19 227 3.0E-27
sp|P76254|YEAX_ECOLI Putative dioxygenase subunit beta YeaX OS=Escherichia coli (strain K12) GN=yeaX PE=3 SV=1 277 444 7.0E-24
sp|Q52186|POBB_PSEPS Phenoxybenzoate dioxygenase subunit beta OS=Pseudomonas pseudoalcaligenes GN=pobB PE=2 SV=1 277 447 5.0E-22
sp|H9N291|NDMD_PSEPU Oxidoreductase NdmD OS=Pseudomonas putida GN=ndmD PE=3 SV=1 277 452 1.0E-19
sp|O54037|VANB_PSEPU Vanillate O-demethylase oxidoreductase OS=Pseudomonas putida GN=vanB PE=3 SV=1 244 451 3.0E-16
sp|P12580|VANB_PSES9 Vanillate O-demethylase oxidoreductase OS=Pseudomonas sp. (strain ATCC 19151) GN=vanB PE=3 SV=1 244 443 4.0E-16
sp|Q05182|PHT2_PSEPU Phthalate 4,5-dioxygenase oxygenase reductase subunit OS=Pseudomonas putida GN=pht2 PE=2 SV=1 277 445 5.0E-16
sp|O24840|VANB_ACIAD Vanillate O-demethylase oxidoreductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=vanB PE=3 SV=1 277 451 1.0E-15
sp|P94680|TSAB1_COMTE Toluene-4-sulfonate monooxygenase system reductase subunit TsaB1 OS=Comamonas testosteroni GN=tsaB1 PE=1 SV=1 277 446 5.0E-15
sp|Q9AHG2|TSAB2_COMTE Putative toluene-4-sulfonate monooxygenase system reductase subunit TsaB2 OS=Comamonas testosteroni GN=tsaB2 PE=5 SV=1 277 446 6.0E-14
sp|O05617|VANB_PSEUH Vanillate O-demethylase oxidoreductase OS=Pseudomonas sp. (strain HR199 / DSM 7063) GN=vanB PE=3 SV=1 277 445 2.0E-13
sp|Q44257|CBAB_COMTE 3-chlorobenzoate-3,4-dioxygenase reductase subunit OS=Comamonas testosteroni GN=cbaB PE=3 SV=2 238 440 4.0E-12
sp|P33164|PDR_BURCE Phthalate dioxygenase reductase OS=Burkholderia cepacia GN=ophA1 PE=1 SV=3 239 445 7.0E-10
sp|O85675|ANTDC_ACIAD Anthranilate 1,2-dioxygenase electron transfer component OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=antC PE=1 SV=1 192 452 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0030151 molybdenum ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0048037 cofactor binding No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0050662 coenzyme binding No
GO:0046914 transition metal ion binding No
GO:0070279 vitamin B6 binding No
GO:0019842 vitamin binding No
GO:0043168 anion binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1490
MTSRSSLKELTRAFEADTLLEIRVSGMKKMSGLNTMSGIDKKICAGPVKISRLGLEGDEHDLTFHGGPDKAVLGY
CSSHYPDWQSSYPDRSDRFVPGGFGENFVTTHMNERNVCVGDVMSVGPQVRLQVSLPRQPCFKLNHRFSLKNFAP
VTYQTSRTGWYYRVLQEGTVSAGDEIRLVSRKWPQWTVERVQEYLHRDKDNLEMNRQLAEVTDLGEESRAQFRKR
VAAAARRSKKVADKDAWKDFKITSRKTETQRIISLVLEAVTPQHDSETKLIGAHARIKLPNGLVRSYSVVAGGDK
DDPNSSYKLEFGIALEDNSRGGSSYLHESAKVGDVLQVGRVTTGVAAASFASHHCFIVGGIGLTAFLAMMQKIQA
INWSYTLHYAVRSADDIPFRDRLEPLRQNVILYDKAQGQRMDIQGIVKGLTWNSQLYVCGPDRMMTAVRDAVDAC
GIPPSE*
Coding >Hirsu2|1490
ATGACATCCCGCTCTTCCCTCAAAGAACTGACGCGAGCATTCGAGGCGGATACTCTACTCGAGATTCGCGTCTCA
GGCATGAAAAAGATGTCCGGACTGAATACCATGTCGGGAATCGACAAGAAGATCTGCGCCGGCCCAGTCAAGATC
AGCAGGCTTGGGCTCGAGGGAGATGAGCACGACCTGACCTTCCACGGCGGCCCTGACAAGGCCGTCCTCGGCTAC
TGTTCCTCGCACTATCCCGACTGGCAGTCATCCTACCCCGACCGCTCCGACAGATTCGTGCCTGGAGGATTCGGT
GAAAACTTCGTAACAACGCACATGAACGAGCGGAACGTCTGCGTCGGCGATGTCATGTCCGTCGGGCCTCAAGTC
CGCCTTCAGGTGTCTCTTCCTCGCCAGCCCTGCTTCAAATTGAACCATCGCTTCTCCCTCAAGAACTTTGCTCCC
GTCACCTACCAAACCAGCCGCACCGGCTGGTATTACAGAGTGCTCCAAGAAGGCACAGTTAGTGCCGGCGATGAG
ATCAGGCTTGTTTCGAGGAAATGGCCCCAGTGGACGGTGGAGCGGGTCCAGGAGTACTTACACCGAGACAAGGAC
AACTTGGAGATGAATCGACAGCTGGCAGAGGTCACCGATCTCGGGGAAGAAAGTCGTGCACAGTTTCGAAAGAGG
GTTGCGGCTGCGGCGAGAAGGTCCAAGAAGGTAGCCGATAAAGACGCGTGGAAAGACTTCAAGATCACAAGCCGG
AAGACGGAAACACAAAGGATCATTTCGCTAGTCTTGGAAGCAGTCACGCCGCAACATGACAGCGAGACGAAGCTC
ATCGGCGCTCACGCCAGAATCAAGCTACCCAACGGCCTCGTCAGGTCGTACTCGGTCGTGGCCGGCGGAGACAAA
GACGACCCGAATTCGTCTTACAAGCTCGAGTTTGGTATTGCTCTGGAGGACAACAGCCGGGGAGGCTCAAGCTAT
CTCCACGAGTCAGCCAAAGTCGGCGACGTCCTGCAAGTGGGCAGAGTCACGACCGGTGTTGCCGCGGCGAGCTTC
GCGAGCCACCACTGCTTCATCGTAGGTGGCATTGGCCTGACGGCCTTTCTCGCCATGATGCAGAAAATACAGGCC
ATCAACTGGAGCTACACACTGCACTACGCGGTGCGGTCCGCCGACGACATACCGTTCCGGGACCGGCTAGAGCCC
CTGAGACAGAACGTCATCTTGTACGACAAGGCTCAGGGCCAGCGGATGGACATCCAAGGCATCGTCAAGGGCCTC
ACCTGGAACAGTCAGCTCTACGTCTGCGGCCCCGATCGAATGATGACGGCCGTCCGGGACGCGGTGGACGCCTGC
GGGATCCCGCCCAGCGAGTGA
Transcript >Hirsu2|1490
ATGACATCCCGCTCTTCCCTCAAAGAACTGACGCGAGCATTCGAGGCGGATACTCTACTCGAGATTCGCGTCTCA
GGCATGAAAAAGATGTCCGGACTGAATACCATGTCGGGAATCGACAAGAAGATCTGCGCCGGCCCAGTCAAGATC
AGCAGGCTTGGGCTCGAGGGAGATGAGCACGACCTGACCTTCCACGGCGGCCCTGACAAGGCCGTCCTCGGCTAC
TGTTCCTCGCACTATCCCGACTGGCAGTCATCCTACCCCGACCGCTCCGACAGATTCGTGCCTGGAGGATTCGGT
GAAAACTTCGTAACAACGCACATGAACGAGCGGAACGTCTGCGTCGGCGATGTCATGTCCGTCGGGCCTCAAGTC
CGCCTTCAGGTGTCTCTTCCTCGCCAGCCCTGCTTCAAATTGAACCATCGCTTCTCCCTCAAGAACTTTGCTCCC
GTCACCTACCAAACCAGCCGCACCGGCTGGTATTACAGAGTGCTCCAAGAAGGCACAGTTAGTGCCGGCGATGAG
ATCAGGCTTGTTTCGAGGAAATGGCCCCAGTGGACGGTGGAGCGGGTCCAGGAGTACTTACACCGAGACAAGGAC
AACTTGGAGATGAATCGACAGCTGGCAGAGGTCACCGATCTCGGGGAAGAAAGTCGTGCACAGTTTCGAAAGAGG
GTTGCGGCTGCGGCGAGAAGGTCCAAGAAGGTAGCCGATAAAGACGCGTGGAAAGACTTCAAGATCACAAGCCGG
AAGACGGAAACACAAAGGATCATTTCGCTAGTCTTGGAAGCAGTCACGCCGCAACATGACAGCGAGACGAAGCTC
ATCGGCGCTCACGCCAGAATCAAGCTACCCAACGGCCTCGTCAGGTCGTACTCGGTCGTGGCCGGCGGAGACAAA
GACGACCCGAATTCGTCTTACAAGCTCGAGTTTGGTATTGCTCTGGAGGACAACAGCCGGGGAGGCTCAAGCTAT
CTCCACGAGTCAGCCAAAGTCGGCGACGTCCTGCAAGTGGGCAGAGTCACGACCGGTGTTGCCGCGGCGAGCTTC
GCGAGCCACCACTGCTTCATCGTAGGTGGCATTGGCCTGACGGCCTTTCTCGCCATGATGCAGAAAATACAGGCC
ATCAACTGGAGCTACACACTGCACTACGCGGTGCGGTCCGCCGACGACATACCGTTCCGGGACCGGCTAGAGCCC
CTGAGACAGAACGTCATCTTGTACGACAAGGCTCAGGGCCAGCGGATGGACATCCAAGGCATCGTCAAGGGCCTC
ACCTGGAACAGTCAGCTCTACGTCTGCGGCCCCGATCGAATGATGACGGCCGTCCGGGACGCGGTGGACGCCTGC
GGGATCCCGCCCAGCGAGTGA
Gene >Hirsu2|1490
ATGACATCCCGCTCTTCCCTCAAAGAACTGACGCGAGCATTCGAGGCGGATACTCTACTCGAGATTCGCGTCTCA
GGCATGAAAAAGATGTCCGGACTGAATACCATGTCGGGAATCGACAAGAAGATCTGCGCCGGCCCAGTCAAGATC
AGCAGGCTTGGGCTCGAGGGAGATGAGCACGACCTGACCTTCCACGGCGGCCCTGACAAGGCCGTCCTCGGCTGT
GAGACTTCTTTTCTGCCCGCTCTCTCGCAATGGCATGATCCGTCGTAACACTGAATCGCGCAGACTGTTCCTCGC
ACTATCCCGACTGGCAGTCATCCTACCCCGACCGCTCCGACAGATTCGTGCCTGGAGGATTCGGTGAAAACTTCG
TAACAACGCACATGAACGAGCGGAACGTCTGCGTCGGCGATGTCATGTCCGTCGGGCCTCAAGTCCGCCTTCAGG
TGTCTCTTCCTCGCCAGCCCTGCTTCAAATTGAACCATCGCTTCTCCCTCAAGAACTTTGCTCCCGTCACCTACC
AAACCAGCCGCACCGGCTGGTATTACAGAGTGCTCCAAGAAGGCACAGTTAGTGCCGGCGATGAGATCAGGCTTG
TTTCGAGGAAATGGCCCCAGTGGACGGTGGAGCGGGTCCAGGAGTACTTACACCGAGACAAGGACAACTTGGAGA
TGAATCGACAGCTGGCAGAGGTCACCGATCTCGGGGAAGAAAGTCGTGCACAGTTTCGAAAGAGGGTTGCGGCTG
CGGCGAGAAGGTCCAAGAAGGTAGCCGATAAAGACGCGTGGAAAGACTTCAAGATCACAAGCCGGAAGACGGAAA
CACAAAGGATCATTTCGCTAGTCTTGGAAGCAGTCACGCCGCAACATGACAGCGAGACGAAGCTCATCGGCGCTC
ACGCCAGAATCAAGCTACCCAACGGCCTCGTCAGGTCGTACTCGGTCGTGGCCGGCGGAGACAAAGACGACCCGA
ATTCGTCTTACAAGCTCGAGTTTGGTATTGCTCTGGAGGACAACAGCCGGGGAGGCTCAAGCTATCTCCACGAGT
CAGCCAAAGTCGGCGACGTCCTGCAAGTGGGCAGAGTCACGACCGGTGTTGCCGCGGCGAGCTTCGCGAGCCACC
ACTGCTTCATCGTAGGTGGCATTGGCCTGACGGCCTTTCTCGCCATGATGCAGAAAATACAGGCCATCAACTGGA
GCTACACACTGCACTACGCGGTGCGGTCCGCCGACGACATACCGTTCCGGGACCGGCTAGAGCCCCTGAGACAGA
ACGTCATCTTGTACGACAAGGCTCAGGGCCAGCGGATGGACATCCAAGGCATCGTCAAGGGCCTCACCTGGAACA
GTCAGCTCTACGTCTGCGGCCCCGATCGAATGATGACGGCCGTCCGGGACGCGGTGGACGCCTGCGGGATCCCGC
CCAGCGAGGTCCACTTCGAGGCATTTGCCGCCGACATCTCGGGCGACCCGTTCAAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail