Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|149
Gene name
LocationContig_1023:7191..8898
Strand+
Gene length (bp)1707
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 1.8E-68 91 484

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10058|YAM3_SCHPO Putative oxidoreductase C1F5.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.03c PE=3 SV=1 85 502 1.0E-60
sp|P38758|TDA3_YEAST Putative oxidoreductase TDA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA3 PE=1 SV=2 223 504 5.0E-52
sp|P38758|TDA3_YEAST Putative oxidoreductase TDA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA3 PE=1 SV=2 86 190 9.0E-20

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 91 108 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|149
MLNDAVAVRCRPNSLSLSSPASRPVLSLPAARSRSVPDKAASAARPRPARHSPRRTSAAEPPISVARSASASGLS
RLGSGAKRAMDGRRNIVIVGGGIIGCTTAYYLTRHPSFNPALHTITLLEAAPTVAAGASGKAGGLLALWAYPACL
VPLSYRLHAELAAEHDGARRWGYRRLTCGSFQATVSRERIGQLHSPGSDGGKAWEKLPKRDRAADNMLESGSLPE
ALDWVDRDSVTGWEEMGSASTAATSQVHPLHFTTSIADLARQAGVEVRTNAKVTSVVTSKTGVEKVDYFDRRANE
DKEIREATDVIITAGPWTGRLLPRSKVEGLRAHSVVYEADVSPFAVFTDIRLPPDFVPEHRAKRGQKRMHKGSVD
PEIYARPFGEVYACGEPDTAVPLPDTADGVQLDEAQCDDIISYIATVSPVLGAAPIKAKQACYLPRHMRFGQESG
PLLGRTTVAGLWVAAGHTCWGIQNGPATGKLMAEFIFDGAATSADVEKLDPRKFKV*
Coding >Hirsu2|149
ATGCTCAACGACGCCGTTGCCGTCCGCTGCCGCCCGAATAGCCTCAGCTTGTCGAGCCCAGCATCCCGGCCCGTC
CTGAGTCTGCCCGCGGCCCGCTCCCGCTCCGTGCCCGACAAAGCCGCCTCCGCCGCTCGGCCCCGCCCGGCGCGC
CACAGCCCTCGTCGCACGAGCGCTGCCGAACCGCCCATCTCCGTCGCCCGCTCGGCCTCGGCCTCGGGCTTGAGC
CGCCTCGGCTCCGGAGCCAAGCGAGCCATGGACGGGAGGCGCAACATCGTCATTGTCGGCGGCGGCATCATCGGC
TGCACGACGGCCTACTACCTGACCCGCCACCCCAGCTTCAACCCGGCCCTCCACACCATCACCCTGCTCGAGGCC
GCGCCCACCGTCGCGGCCGGGGCGTCGGGCAAGGCCGGCGGCCTGCTCGCCCTGTGGGCCTATCCCGCCTGCCTC
GTCCCGCTCTCCTATCGGCTGCACGCCGAGCTGGCGGCCGAGCACGACGGCGCGCGGCGGTGGGGGTACAGGAGG
CTCACCTGCGGCAGCTTCCAGGCGACCGTCTCCCGCGAGAGGATCGGCCAGCTGCACAGTCCGGGGAGCGACGGG
GGCAAGGCCTGGGAGAAGCTGCCCAAGCGCGACCGTGCCGCTGACAACATGCTGGAGTCCGGCTCCCTGCCGGAG
GCGCTGGACTGGGTTGATCGGGACTCCGTCACGGGATGGGAGGAGATGGGCAGCGCCAGCACGGCCGCCACCTCG
CAGGTCCATCCGCTGCACTTCACCACCTCCATCGCCGACCTCGCCCGCCAGGCAGGCGTCGAGGTGAGGACGAAT
GCCAAGGTCACCAGCGTCGTCACGTCCAAGACGGGCGTCGAAAAGGTCGACTACTTCGACCGACGGGCCAACGAG
GATAAGGAGATCCGCGAGGCGACCGACGTCATCATCACCGCCGGCCCGTGGACGGGGCGCCTTCTGCCGCGGTCC
AAGGTCGAGGGCCTCCGGGCGCACAGTGTCGTGTACGAGGCCGACGTGAGCCCGTTCGCCGTCTTCACCGACATC
CGGCTGCCGCCCGACTTCGTCCCGGAGCATCGCGCCAAGAGGGGCCAGAAGAGGATGCACAAGGGCTCCGTCGAT
CCCGAGATCTACGCAAGGCCCTTTGGCGAGGTATACGCGTGCGGCGAGCCGGACACGGCCGTGCCCCTACCGGAC
ACGGCAGACGGGGTGCAGCTTGACGAGGCCCAGTGCGACGACATCATCTCTTACATCGCCACCGTGAGTCCCGTC
CTCGGCGCAGCACCCATCAAAGCCAAGCAGGCCTGCTACCTGCCGCGGCACATGCGCTTCGGCCAGGAGAGCGGC
CCGCTGCTGGGCCGCACGACCGTCGCCGGGCTGTGGGTCGCGGCCGGCCACACCTGCTGGGGCATCCAAAATGGC
CCGGCCACGGGCAAGCTCATGGCCGAGTTCATCTTTGACGGCGCGGCGACGAGTGCGGACGTGGAGAAGCTCGAC
CCGAGGAAATTCAAGGTCTGA
Transcript >Hirsu2|149
ATGCTCAACGACGCCGTTGCCGTCCGCTGCCGCCCGAATAGCCTCAGCTTGTCGAGCCCAGCATCCCGGCCCGTC
CTGAGTCTGCCCGCGGCCCGCTCCCGCTCCGTGCCCGACAAAGCCGCCTCCGCCGCTCGGCCCCGCCCGGCGCGC
CACAGCCCTCGTCGCACGAGCGCTGCCGAACCGCCCATCTCCGTCGCCCGCTCGGCCTCGGCCTCGGGCTTGAGC
CGCCTCGGCTCCGGAGCCAAGCGAGCCATGGACGGGAGGCGCAACATCGTCATTGTCGGCGGCGGCATCATCGGC
TGCACGACGGCCTACTACCTGACCCGCCACCCCAGCTTCAACCCGGCCCTCCACACCATCACCCTGCTCGAGGCC
GCGCCCACCGTCGCGGCCGGGGCGTCGGGCAAGGCCGGCGGCCTGCTCGCCCTGTGGGCCTATCCCGCCTGCCTC
GTCCCGCTCTCCTATCGGCTGCACGCCGAGCTGGCGGCCGAGCACGACGGCGCGCGGCGGTGGGGGTACAGGAGG
CTCACCTGCGGCAGCTTCCAGGCGACCGTCTCCCGCGAGAGGATCGGCCAGCTGCACAGTCCGGGGAGCGACGGG
GGCAAGGCCTGGGAGAAGCTGCCCAAGCGCGACCGTGCCGCTGACAACATGCTGGAGTCCGGCTCCCTGCCGGAG
GCGCTGGACTGGGTTGATCGGGACTCCGTCACGGGATGGGAGGAGATGGGCAGCGCCAGCACGGCCGCCACCTCG
CAGGTCCATCCGCTGCACTTCACCACCTCCATCGCCGACCTCGCCCGCCAGGCAGGCGTCGAGGTGAGGACGAAT
GCCAAGGTCACCAGCGTCGTCACGTCCAAGACGGGCGTCGAAAAGGTCGACTACTTCGACCGACGGGCCAACGAG
GATAAGGAGATCCGCGAGGCGACCGACGTCATCATCACCGCCGGCCCGTGGACGGGGCGCCTTCTGCCGCGGTCC
AAGGTCGAGGGCCTCCGGGCGCACAGTGTCGTGTACGAGGCCGACGTGAGCCCGTTCGCCGTCTTCACCGACATC
CGGCTGCCGCCCGACTTCGTCCCGGAGCATCGCGCCAAGAGGGGCCAGAAGAGGATGCACAAGGGCTCCGTCGAT
CCCGAGATCTACGCAAGGCCCTTTGGCGAGGTATACGCGTGCGGCGAGCCGGACACGGCCGTGCCCCTACCGGAC
ACGGCAGACGGGGTGCAGCTTGACGAGGCCCAGTGCGACGACATCATCTCTTACATCGCCACCGTGAGTCCCGTC
CTCGGCGCAGCACCCATCAAAGCCAAGCAGGCCTGCTACCTGCCGCGGCACATGCGCTTCGGCCAGGAGAGCGGC
CCGCTGCTGGGCCGCACGACCGTCGCCGGGCTGTGGGTCGCGGCCGGCCACACCTGCTGGGGCATCCAAAATGGC
CCGGCCACGGGCAAGCTCATGGCCGAGTTCATCTTTGACGGCGCGGCGACGAGTGCGGACGTGGAGAAGCTCGAC
CCGAGGAAATTCAAGGTCTGA
Gene >Hirsu2|149
ATGCTCAACGACGCCGTTGCCGTCCGCTGCCGCCCGAATAGCCTCAGCTTGTCGAGCCCAGCATCCCGGCCCGTC
CTGAGTCTGCCCGCGGCCCGCTCCCGCTCCGTGCCCGACAAAGCCGCCTCCGCCGCTCGGCCCCGCCCGGCGCGC
CACAGCCCTCGTCGCACGAGCGCTGCCGAACCGCCCATCTCCGTCGCCCGCTCGGCCTCGGCCTCGGGCTTGAGC
CGCCTCGGCTCCGGAGCCAAGCGAGCCATGGACGGGAGGCGCAACATCGTCATTGTCGGTAAGGAGGCCCAGCAG
CACGTGCCCCGGTCGCAATCAACCCTCTGGCTCGGCTGTTGTGCCCTCTTCCTCTCGCCTCGTCCCTGCGTCCCG
GCCGCGGCGTGAAGCCCGACACTCAAACCTTGCGCAGGCGGCGGCATCATCGGCTGCACGACGGCCTACTACCTG
ACCCGCCACCCCAGCTTCAACCCGGCCCTCCACACCATCACCCTGCTCGAGGCCGCGCCCACCGTCGCGGCCGGG
GCGTCGGGCAAGGCCGGCGGCCTGCTCGCCCTGTGGGCCTATCCCGCCTGCCTCGTCCCGCTCTCCTATCGGCTG
CACGCCGAGCTGGCGGCCGAGCACGACGGCGCGCGGCGGTGGGGGTACAGGAGGCTCACCTGCGGCAGCTTCCAG
GCGACCGTCTCCCGCGAGAGGATCGGCCAGCTGCACAGTCCGGGGAGCGACGGGGGCAAGGCCTGGGAGAAGCTG
CCCAAGCGCGACCGTGCCGCTGACAACATGCTGGAGTCCGGCTCCCTGCCGGAGGCGCTGGACTGGGTTGATCGG
GACTCCGTCACGGGATGGGAGGAGATGGGCAGCGCCAGCACGGCCGCCACCTCGCAGGTCCATCCGCTGCACTTC
ACCACCTCCATCGCCGACCTCGCCCGCCAGGCAGGCGTCGAGGTGAGGACGAATGCCAAGGTCACCAGCGTCGTC
ACGTCCAAGACGGGCGTCGAAAAGGTCGACTACTTCGACCGACGGGCCAACGAGGATAAGGAGATCCGCGAGGCG
ACCGACGTCATCATCACCGCCGGCCCGTGGACGGGGCGCCTTCTGCCGCGGTCCAAGGTCGAGGGCCTCCGGGCG
CACAGTGTCGTGTACGAGGCCGACGTGAGCCCGTTCGCCGTCTTCACCGACATCCGGCTGCCGCCCGACTTCGTC
CCGGAGCATCGCGCCAAGAGGGGCCAGAAGAGGATGCACAAGGGCTCCGTCGATCCCGAGATCTACGCAAGGCCC
TTTGGCGAGGTATACGCGTGCGGTGGGTGAACGACAGCTCCCCCCCCTCCCGTCCAAGCGAGGATGCTCATCCGA
ACAGGCGAGCCGGACACGGCCGTGCCCCTACCGGACACGGCAGACGGGGTGCAGCTTGACGAGGCCCAGTGCGAC
GACATCATCTCTTACATCGCCACCGTGAGTCCCGTCCTCGGCGCAGCACCCATCAAAGCCAAGCAGGCCTGCTAC
CTGCCGCGGCACATGCGCTTCGGCCAGGAGAGCGGCCCGCTGCTGGGCCGCACGACCGTCGCCGGGCTGTGGGTC
GCGGCCGGCCACACCTGCTGGGGCATCCAAAATGGCCCGGCCACGGGCAAGCTCATGGCCGAGTTCATCTTTGAC
GGCGCGGCGACGAGTGCGGACGTGGAGAAGCTCGACCCGAGGAAATTCAAGGTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail