Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1487
Gene name
LocationContig_1328:364..2321
Strand+
Gene length (bp)1957
Transcript length (bp)1839
Coding sequence length (bp)1839
Protein length (aa) 613

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03732 Retrotrans_gag Retrotransposon gag protein 5.7E-15 94 194
PF00098 zf-CCHC Zinc knuckle 1.3E-06 278 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N8U3|ZCHC5_HUMAN Zinc finger CCHC domain-containing protein 5 OS=Homo sapiens GN=ZCCHC5 PE=2 SV=1 57 293 2.0E-14
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 3 227 3.0E-14
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 19 227 5.0E-13
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 12 227 1.0E-11
sp|Q7TN75|PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus GN=Peg10 PE=1 SV=2 54 306 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N8U3|ZCHC5_HUMAN Zinc finger CCHC domain-containing protein 5 OS=Homo sapiens GN=ZCCHC5 PE=2 SV=1 57 293 2.0E-14
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 3 227 3.0E-14
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 19 227 5.0E-13
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 12 227 1.0E-11
sp|Q7TN75|PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus GN=Peg10 PE=1 SV=2 54 306 1.0E-10
sp|Q86TG7|PEG10_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens GN=PEG10 PE=1 SV=2 54 306 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1487
MAPQESSTTAGPTLTPQEMMREIAYLRQQVSRLEGMNETHRVRDLGETVKPKQPGPFDGSHGTLRDFLTQLKAYH
RFYPTQLSDHVAKVLHAGNCLTGTALAWFGPIMKDYLDNDEENRDDETKEIFRKFTNFEDAITKVFGTTDEEREA
EQKLRGLRQRTSASEYAANFRQVTSQLDWDDEPLMSRFYEGLKEEVKDELYKEDRPNNLSDYIAMAVRIDDRQYA
RRQQKKQGKGYWNTPYTSNRRANYKKKREEPIAYAHTTNPGKMDLDATTESGKKCFNCGKFGHFARECKKPKKKG
PWTPVPEGGKQLNATSKARPNHDLMSWTACYDDDCYTHLSDKNATGWFPKAPKKKTLAMVLRRTPFKQAQLKKTG
ISQQSTDDTSSGEELDTPDVSETEEVLPPTLRRETTVIGTTSEPAPLTDVQKSALIRYQPVPRGGDHAVAITAID
TATALQSGWTPRGRLGDDPRTLPSHEHHAQVSWASCIYLTCMTHFRTKARNDAFPIRNGSLPISRPYGDRELRHW
RIIKDYPHDKVMLLEPDSNTPIKCRDDTNLLSTCDSMTFTNAHTRNAQNICATKLATGISKQTAHQRITGKKEVT
TRKDSPKENSLR*
Coding >Hirsu2|1487
ATGGCACCTCAAGAGTCATCCACCACTGCCGGACCTACCCTCACTCCACAGGAGATGATGCGGGAAATCGCCTAC
CTCCGACAGCAGGTAAGTAGACTCGAAGGCATGAACGAAACTCACCGCGTTAGGGATCTCGGAGAGACAGTCAAA
CCAAAGCAGCCAGGACCCTTTGACGGATCCCACGGCACGCTACGAGACTTTCTCACGCAACTCAAAGCCTACCAC
AGGTTTTATCCCACACAGCTATCCGACCATGTAGCAAAGGTGTTACATGCTGGCAACTGCCTTACAGGCACCGCA
TTGGCATGGTTTGGACCCATCATGAAGGATTATCTTGACAATGATGAGGAAAATCGCGATGACGAGACCAAAGAA
ATATTCAGGAAGTTTACAAACTTCGAGGACGCCATCACCAAGGTATTTGGTACAACGGACGAAGAACGAGAGGCA
GAACAGAAGCTCCGTGGACTACGCCAGCGGACCTCAGCCTCCGAGTACGCAGCCAACTTCCGACAGGTCACCTCA
CAGCTCGACTGGGACGATGAACCTCTCATGTCTCGGTTCTACGAAGGACTCAAAGAAGAAGTCAAAGACGAGCTT
TACAAGGAAGATCGACCAAACAACTTATCGGACTACATCGCTATGGCCGTACGGATCGACGACAGACAGTATGCA
CGACGCCAGCAAAAGAAGCAAGGAAAAGGGTATTGGAATACGCCTTACACAAGTAATCGACGAGCGAACTATAAG
AAGAAACGCGAAGAACCAATCGCTTACGCTCATACGACGAATCCAGGAAAAATGGACCTTGACGCTACTACTGAG
AGCGGAAAGAAATGCTTCAATTGCGGAAAATTCGGACACTTTGCCAGGGAATGCAAGAAACCGAAGAAGAAAGGA
CCTTGGACGCCAGTACCCGAGGGCGGAAAGCAACTCAACGCAACCAGCAAGGCAAGACCTAACCATGATCTTATG
AGTTGGACAGCATGCTACGATGACGACTGCTACACGCACCTCAGTGATAAGAACGCAACTGGATGGTTCCCAAAG
GCACCTAAGAAGAAAACACTTGCAATGGTTCTACGACGAACACCATTTAAGCAAGCACAGCTCAAGAAAACTGGA
ATAAGCCAGCAGAGCACCGACGACACAAGCTCAGGAGAAGAGCTGGATACACCAGATGTGTCAGAAACCGAGGAG
GTCTTACCACCTACCTTACGGCGAGAAACGACAGTGATTGGGACTACATCGGAACCAGCACCTCTCACAGATGTC
CAGAAGTCAGCACTTATACGATATCAGCCGGTACCACGCGGAGGCGACCACGCTGTGGCTATAACCGCCATCGAC
ACTGCTACTGCACTTCAGTCTGGATGGACCCCAAGAGGAAGACTCGGAGATGACCCACGGACACTGCCAAGTCAC
GAACATCACGCACAAGTCTCATGGGCATCATGCATCTACCTTACTTGCATGACGCACTTTCGAACCAAGGCGCGA
AACGACGCATTCCCCATTAGGAATGGCTCATTACCGATATCGCGACCATACGGAGACAGAGAACTGCGACACTGG
AGGATCATCAAGGACTATCCTCACGACAAAGTCATGTTGCTCGAACCGGACAGCAACACGCCGATTAAATGTCGA
GACGACACCAACTTGCTATCGACATGCGACTCGATGACATTCACGAATGCCCACACCCGGAATGCACAGAACATA
TGCGCGACAAAGCTCGCGACTGGCATAAGCAAGCAAACGGCACACCAGCGGATTACTGGAAAGAAAGAAGTGACA
ACCAGAAAAGATTCACCAAAGGAGAACTCACTCCGATAG
Transcript >Hirsu2|1487
ATGGCACCTCAAGAGTCATCCACCACTGCCGGACCTACCCTCACTCCACAGGAGATGATGCGGGAAATCGCCTAC
CTCCGACAGCAGGTAAGTAGACTCGAAGGCATGAACGAAACTCACCGCGTTAGGGATCTCGGAGAGACAGTCAAA
CCAAAGCAGCCAGGACCCTTTGACGGATCCCACGGCACGCTACGAGACTTTCTCACGCAACTCAAAGCCTACCAC
AGGTTTTATCCCACACAGCTATCCGACCATGTAGCAAAGGTGTTACATGCTGGCAACTGCCTTACAGGCACCGCA
TTGGCATGGTTTGGACCCATCATGAAGGATTATCTTGACAATGATGAGGAAAATCGCGATGACGAGACCAAAGAA
ATATTCAGGAAGTTTACAAACTTCGAGGACGCCATCACCAAGGTATTTGGTACAACGGACGAAGAACGAGAGGCA
GAACAGAAGCTCCGTGGACTACGCCAGCGGACCTCAGCCTCCGAGTACGCAGCCAACTTCCGACAGGTCACCTCA
CAGCTCGACTGGGACGATGAACCTCTCATGTCTCGGTTCTACGAAGGACTCAAAGAAGAAGTCAAAGACGAGCTT
TACAAGGAAGATCGACCAAACAACTTATCGGACTACATCGCTATGGCCGTACGGATCGACGACAGACAGTATGCA
CGACGCCAGCAAAAGAAGCAAGGAAAAGGGTATTGGAATACGCCTTACACAAGTAATCGACGAGCGAACTATAAG
AAGAAACGCGAAGAACCAATCGCTTACGCTCATACGACGAATCCAGGAAAAATGGACCTTGACGCTACTACTGAG
AGCGGAAAGAAATGCTTCAATTGCGGAAAATTCGGACACTTTGCCAGGGAATGCAAGAAACCGAAGAAGAAAGGA
CCTTGGACGCCAGTACCCGAGGGCGGAAAGCAACTCAACGCAACCAGCAAGGCAAGACCTAACCATGATCTTATG
AGTTGGACAGCATGCTACGATGACGACTGCTACACGCACCTCAGTGATAAGAACGCAACTGGATGGTTCCCAAAG
GCACCTAAGAAGAAAACACTTGCAATGGTTCTACGACGAACACCATTTAAGCAAGCACAGCTCAAGAAAACTGGA
ATAAGCCAGCAGAGCACCGACGACACAAGCTCAGGAGAAGAGCTGGATACACCAGATGTGTCAGAAACCGAGGAG
GTCTTACCACCTACCTTACGGCGAGAAACGACAGTGATTGGGACTACATCGGAACCAGCACCTCTCACAGATGTC
CAGAAGTCAGCACTTATACGATATCAGCCGGTACCACGCGGAGGCGACCACGCTGTGGCTATAACCGCCATCGAC
ACTGCTACTGCACTTCAGTCTGGATGGACCCCAAGAGGAAGACTCGGAGATGACCCACGGACACTGCCAAGTCAC
GAACATCACGCACAAGTCTCATGGGCATCATGCATCTACCTTACTTGCATGACGCACTTTCGAACCAAGGCGCGA
AACGACGCATTCCCCATTAGGAATGGCTCATTACCGATATCGCGACCATACGGAGACAGAGAACTGCGACACTGG
AGGATCATCAAGGACTATCCTCACGACAAAGTCATGTTGCTCGAACCGGACAGCAACACGCCGATTAAATGTCGA
GACGACACCAACTTGCTATCGACATGCGACTCGATGACATTCACGAATGCCCACACCCGGAATGCACAGAACATA
TGCGCGACAAAGCTCGCGACTGGCATAAGCAAGCAAACGGCACACCAGCGGATTACTGGAAAGAAAGAAGTGACA
ACCAGAAAAGATTCACCAAAGGAGAACTCACTCCGATAG
Gene >Hirsu2|1487
ATGGCACCTCAAGAGTCATCCACCACTGCCGGACCTACCCTCACTCCACAGGAGATGATGCGGGAAATCGCCTAC
CTCCGACAGCAGGTAAGTAGACTCGAAGGCATGAACGAAACTCACCGCGTTAGGGATCTCGGAGAGACAGTCAAA
CCAAAGCAGCCAGGACCCTTTGACGGATCCCACGGCACGCTACGAGACTTTCTCACGCAACTCAAAGCCTACCAC
AGGTTTTATCCCACACAGCTATCCGACCATGTAGCAAAGGTGTTACATGCTGGCAACTGCCTTACAGGCACCGCA
TTGGCATGGTTTGGACCCATCATGAAGGATTATCTTGACAATGATGAGGAAAATCGCGATGACGAGACCAAAGAA
ATATTCAGGAAGTTTACAAACTTCGAGGACGCCATCACCAAGGTATTTGGTACAACGGACGAAGAACGAGAGGCA
GAACAGAAGCTCCGTGGACTACGCCAGCGGACCTCAGCCTCCGAGTACGCAGCCAACTTCCGACAGGTCACCTCA
CAGCTCGACTGGGACGATGAACCTCTCATGTCTCGGTTCTACGAAGGACTCAAAGAAGAAGTCAAAGACGAGCTT
TACAAGGAAGATCGACCAAACAACTTATCGGACTACATCGCTATGGCCGTACGGATCGACGACAGACAGTATGCA
CGACGCCAGCAAAAGAAGCAAGGAAAAGGGTATTGGAATACGCCTTACACAAGTAATCGACGAGCGAACTATAAG
AAGAAACGCGAAGAACCAATCGCTTACGCTCATACGACGAATCCAGGAAAAATGGACCTTGACGCTACTACTGAG
AGCGGAAAGAAATGCTTCAATTGCGGAAAATTCGGACACTTTGCCAGGGAATGCAAGAAACCGAAGAAGAAAGGA
CCTTGGACGCCAGTACCCGAGGGCGGAAAGCAACTCAACGCAACCAGCAAGGCAAGACCTAACCATGATCTTATG
AGTTGGACAGCATGCTACGATGACGACTGCTACACGCACCTCAGTGATAAGAACGCAACTGGATGGTTCCCAAAG
GCACCTAAGAAGAAAACACTTGCAATGGTTCTACGACGAACACCATTTAAGCAAGCACAGCTCAAGAAAACTGGA
ATAAGCCAGCAGAGCACCGACGACACAAGCTCAGGAGAAGAGCTGGATACACCAGATGTGTCAGAAACCGAGGAG
GTCTTACCACCTACCTTACGGCGAGAAACGACAGTGATTGGGACTACATCGGAACCAGCACCTCTCACAGATGTC
CAGAAGTCAGCACTTATACGATATCAGCCGGTACCACGCGGAGGCGACCACGCTGTGGCTATAACCGCCATCGAC
ACTGCTACTGCACTTCAGTCTGGATGGACCCCAAGAGGAAGACTCGGAGATGACCCACGGACACTGCCAAGTCAC
GAACATCACGCACAAGTCTCATGGGCATCATGCATCTACCTTACTTGCATGACGCACTTTCGAACCAAGGCGCGA
AACGACGCATTCCCCATTAGGAATGGCTCATTACCGATATCGCGACCATACGGAGACAGAGAACTGCGACACTGG
AGGATCATCAAGGACTATCCTCACGACAAAGTCATGTTGCTCGAACCGGACAGCAACACGCCGATTAAATGTCGA
GACGACACCAACTTGCTATCGACATGCGACTCGATGACATGTCAGATACACGAATTCGGGAAAGTTTGGGAATGG
CATAAATATACGAAGGCAGGACTTCGGAAGCCATCAATCCCGCAAGGACTCCTAATGTCCATTAATTGCGAAGGA
TTCGATAGTCACGAATGCCCACACCCGGAATGCACAGAACATATGCGCGACAAAGCTCGCGACTGGCATAAGCAA
GCAAACGGCACACCAGCGGATTACTGGAAAGAAAGAAGTGACAACCAGAAAAGATTCACCAAAGGAGAACTCACT
CCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail