Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1487
Gene name
LocationContig_1328:364..2321
Strand+
Gene length (bp)1957
Transcript length (bp)1839
Coding sequence length (bp)1839
Protein length (aa) 613

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03732 Retrotrans_gag Retrotransposon gag protein 6.2E-15 94 194
PF00098 zf-CCHC Zinc knuckle 1.4E-06 278 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N8U3|ZCHC5_HUMAN Zinc finger CCHC domain-containing protein 5 OS=Homo sapiens GN=ZCCHC5 PE=2 SV=1 57 293 2.0E-14
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 3 227 3.0E-14
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 19 227 5.0E-13
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 12 227 1.0E-11
sp|Q7TN75|PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus GN=Peg10 PE=1 SV=2 54 306 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N8U3|ZCHC5_HUMAN Zinc finger CCHC domain-containing protein 5 OS=Homo sapiens GN=ZCCHC5 PE=2 SV=1 57 293 2.0E-14
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 3 227 3.0E-14
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 19 227 5.0E-13
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 12 227 1.0E-11
sp|Q7TN75|PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus GN=Peg10 PE=1 SV=2 54 306 1.0E-10
sp|Q86TG7|PEG10_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens GN=PEG10 PE=1 SV=2 54 306 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0046914 transition metal ion binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5442 0.5248 0.4165 0.1866 0.0397 0.0322 0.2079 0.2004 0.0254 0.0013

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7496
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|1487 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1487
MAPQESSTTAGPTLTPQEMMREIAYLRQQVSRLEGMNETHRVRDLGETVKPKQPGPFDGSHGTLRDFLTQLKAYH
RFYPTQLSDHVAKVLHAGNCLTGTALAWFGPIMKDYLDNDEENRDDETKEIFRKFTNFEDAITKVFGTTDEEREA
EQKLRGLRQRTSASEYAANFRQVTSQLDWDDEPLMSRFYEGLKEEVKDELYKEDRPNNLSDYIAMAVRIDDRQYA
RRQQKKQGKGYWNTPYTSNRRANYKKKREEPIAYAHTTNPGKMDLDATTESGKKCFNCGKFGHFARECKKPKKKG
PWTPVPEGGKQLNATSKARPNHDLMSWTACYDDDCYTHLSDKNATGWFPKAPKKKTLAMVLRRTPFKQAQLKKTG
ISQQSTDDTSSGEELDTPDVSETEEVLPPTLRRETTVIGTTSEPAPLTDVQKSALIRYQPVPRGGDHAVAITAID
TATALQSGWTPRGRLGDDPRTLPSHEHHAQVSWASCIYLTCMTHFRTKARNDAFPIRNGSLPISRPYGDRELRHW
RIIKDYPHDKVMLLEPDSNTPIKCRDDTNLLSTCDSMTFTNAHTRNAQNICATKLATGISKQTAHQRITGKKEVT
TRKDSPKENSLR*
Coding >Hirsu2|1487
ATGGCACCTCAAGAGTCATCCACCACTGCCGGACCTACCCTCACTCCACAGGAGATGATGCGGGAAATCGCCTAC
CTCCGACAGCAGGTAAGTAGACTCGAAGGCATGAACGAAACTCACCGCGTTAGGGATCTCGGAGAGACAGTCAAA
CCAAAGCAGCCAGGACCCTTTGACGGATCCCACGGCACGCTACGAGACTTTCTCACGCAACTCAAAGCCTACCAC
AGGTTTTATCCCACACAGCTATCCGACCATGTAGCAAAGGTGTTACATGCTGGCAACTGCCTTACAGGCACCGCA
TTGGCATGGTTTGGACCCATCATGAAGGATTATCTTGACAATGATGAGGAAAATCGCGATGACGAGACCAAAGAA
ATATTCAGGAAGTTTACAAACTTCGAGGACGCCATCACCAAGGTATTTGGTACAACGGACGAAGAACGAGAGGCA
GAACAGAAGCTCCGTGGACTACGCCAGCGGACCTCAGCCTCCGAGTACGCAGCCAACTTCCGACAGGTCACCTCA
CAGCTCGACTGGGACGATGAACCTCTCATGTCTCGGTTCTACGAAGGACTCAAAGAAGAAGTCAAAGACGAGCTT
TACAAGGAAGATCGACCAAACAACTTATCGGACTACATCGCTATGGCCGTACGGATCGACGACAGACAGTATGCA
CGACGCCAGCAAAAGAAGCAAGGAAAAGGGTATTGGAATACGCCTTACACAAGTAATCGACGAGCGAACTATAAG
AAGAAACGCGAAGAACCAATCGCTTACGCTCATACGACGAATCCAGGAAAAATGGACCTTGACGCTACTACTGAG
AGCGGAAAGAAATGCTTCAATTGCGGAAAATTCGGACACTTTGCCAGGGAATGCAAGAAACCGAAGAAGAAAGGA
CCTTGGACGCCAGTACCCGAGGGCGGAAAGCAACTCAACGCAACCAGCAAGGCAAGACCTAACCATGATCTTATG
AGTTGGACAGCATGCTACGATGACGACTGCTACACGCACCTCAGTGATAAGAACGCAACTGGATGGTTCCCAAAG
GCACCTAAGAAGAAAACACTTGCAATGGTTCTACGACGAACACCATTTAAGCAAGCACAGCTCAAGAAAACTGGA
ATAAGCCAGCAGAGCACCGACGACACAAGCTCAGGAGAAGAGCTGGATACACCAGATGTGTCAGAAACCGAGGAG
GTCTTACCACCTACCTTACGGCGAGAAACGACAGTGATTGGGACTACATCGGAACCAGCACCTCTCACAGATGTC
CAGAAGTCAGCACTTATACGATATCAGCCGGTACCACGCGGAGGCGACCACGCTGTGGCTATAACCGCCATCGAC
ACTGCTACTGCACTTCAGTCTGGATGGACCCCAAGAGGAAGACTCGGAGATGACCCACGGACACTGCCAAGTCAC
GAACATCACGCACAAGTCTCATGGGCATCATGCATCTACCTTACTTGCATGACGCACTTTCGAACCAAGGCGCGA
AACGACGCATTCCCCATTAGGAATGGCTCATTACCGATATCGCGACCATACGGAGACAGAGAACTGCGACACTGG
AGGATCATCAAGGACTATCCTCACGACAAAGTCATGTTGCTCGAACCGGACAGCAACACGCCGATTAAATGTCGA
GACGACACCAACTTGCTATCGACATGCGACTCGATGACATTCACGAATGCCCACACCCGGAATGCACAGAACATA
TGCGCGACAAAGCTCGCGACTGGCATAAGCAAGCAAACGGCACACCAGCGGATTACTGGAAAGAAAGAAGTGACA
ACCAGAAAAGATTCACCAAAGGAGAACTCACTCCGATAG
Transcript >Hirsu2|1487
ATGGCACCTCAAGAGTCATCCACCACTGCCGGACCTACCCTCACTCCACAGGAGATGATGCGGGAAATCGCCTAC
CTCCGACAGCAGGTAAGTAGACTCGAAGGCATGAACGAAACTCACCGCGTTAGGGATCTCGGAGAGACAGTCAAA
CCAAAGCAGCCAGGACCCTTTGACGGATCCCACGGCACGCTACGAGACTTTCTCACGCAACTCAAAGCCTACCAC
AGGTTTTATCCCACACAGCTATCCGACCATGTAGCAAAGGTGTTACATGCTGGCAACTGCCTTACAGGCACCGCA
TTGGCATGGTTTGGACCCATCATGAAGGATTATCTTGACAATGATGAGGAAAATCGCGATGACGAGACCAAAGAA
ATATTCAGGAAGTTTACAAACTTCGAGGACGCCATCACCAAGGTATTTGGTACAACGGACGAAGAACGAGAGGCA
GAACAGAAGCTCCGTGGACTACGCCAGCGGACCTCAGCCTCCGAGTACGCAGCCAACTTCCGACAGGTCACCTCA
CAGCTCGACTGGGACGATGAACCTCTCATGTCTCGGTTCTACGAAGGACTCAAAGAAGAAGTCAAAGACGAGCTT
TACAAGGAAGATCGACCAAACAACTTATCGGACTACATCGCTATGGCCGTACGGATCGACGACAGACAGTATGCA
CGACGCCAGCAAAAGAAGCAAGGAAAAGGGTATTGGAATACGCCTTACACAAGTAATCGACGAGCGAACTATAAG
AAGAAACGCGAAGAACCAATCGCTTACGCTCATACGACGAATCCAGGAAAAATGGACCTTGACGCTACTACTGAG
AGCGGAAAGAAATGCTTCAATTGCGGAAAATTCGGACACTTTGCCAGGGAATGCAAGAAACCGAAGAAGAAAGGA
CCTTGGACGCCAGTACCCGAGGGCGGAAAGCAACTCAACGCAACCAGCAAGGCAAGACCTAACCATGATCTTATG
AGTTGGACAGCATGCTACGATGACGACTGCTACACGCACCTCAGTGATAAGAACGCAACTGGATGGTTCCCAAAG
GCACCTAAGAAGAAAACACTTGCAATGGTTCTACGACGAACACCATTTAAGCAAGCACAGCTCAAGAAAACTGGA
ATAAGCCAGCAGAGCACCGACGACACAAGCTCAGGAGAAGAGCTGGATACACCAGATGTGTCAGAAACCGAGGAG
GTCTTACCACCTACCTTACGGCGAGAAACGACAGTGATTGGGACTACATCGGAACCAGCACCTCTCACAGATGTC
CAGAAGTCAGCACTTATACGATATCAGCCGGTACCACGCGGAGGCGACCACGCTGTGGCTATAACCGCCATCGAC
ACTGCTACTGCACTTCAGTCTGGATGGACCCCAAGAGGAAGACTCGGAGATGACCCACGGACACTGCCAAGTCAC
GAACATCACGCACAAGTCTCATGGGCATCATGCATCTACCTTACTTGCATGACGCACTTTCGAACCAAGGCGCGA
AACGACGCATTCCCCATTAGGAATGGCTCATTACCGATATCGCGACCATACGGAGACAGAGAACTGCGACACTGG
AGGATCATCAAGGACTATCCTCACGACAAAGTCATGTTGCTCGAACCGGACAGCAACACGCCGATTAAATGTCGA
GACGACACCAACTTGCTATCGACATGCGACTCGATGACATTCACGAATGCCCACACCCGGAATGCACAGAACATA
TGCGCGACAAAGCTCGCGACTGGCATAAGCAAGCAAACGGCACACCAGCGGATTACTGGAAAGAAAGAAGTGACA
ACCAGAAAAGATTCACCAAAGGAGAACTCACTCCGATAG
Gene >Hirsu2|1487
ATGGCACCTCAAGAGTCATCCACCACTGCCGGACCTACCCTCACTCCACAGGAGATGATGCGGGAAATCGCCTAC
CTCCGACAGCAGGTAAGTAGACTCGAAGGCATGAACGAAACTCACCGCGTTAGGGATCTCGGAGAGACAGTCAAA
CCAAAGCAGCCAGGACCCTTTGACGGATCCCACGGCACGCTACGAGACTTTCTCACGCAACTCAAAGCCTACCAC
AGGTTTTATCCCACACAGCTATCCGACCATGTAGCAAAGGTGTTACATGCTGGCAACTGCCTTACAGGCACCGCA
TTGGCATGGTTTGGACCCATCATGAAGGATTATCTTGACAATGATGAGGAAAATCGCGATGACGAGACCAAAGAA
ATATTCAGGAAGTTTACAAACTTCGAGGACGCCATCACCAAGGTATTTGGTACAACGGACGAAGAACGAGAGGCA
GAACAGAAGCTCCGTGGACTACGCCAGCGGACCTCAGCCTCCGAGTACGCAGCCAACTTCCGACAGGTCACCTCA
CAGCTCGACTGGGACGATGAACCTCTCATGTCTCGGTTCTACGAAGGACTCAAAGAAGAAGTCAAAGACGAGCTT
TACAAGGAAGATCGACCAAACAACTTATCGGACTACATCGCTATGGCCGTACGGATCGACGACAGACAGTATGCA
CGACGCCAGCAAAAGAAGCAAGGAAAAGGGTATTGGAATACGCCTTACACAAGTAATCGACGAGCGAACTATAAG
AAGAAACGCGAAGAACCAATCGCTTACGCTCATACGACGAATCCAGGAAAAATGGACCTTGACGCTACTACTGAG
AGCGGAAAGAAATGCTTCAATTGCGGAAAATTCGGACACTTTGCCAGGGAATGCAAGAAACCGAAGAAGAAAGGA
CCTTGGACGCCAGTACCCGAGGGCGGAAAGCAACTCAACGCAACCAGCAAGGCAAGACCTAACCATGATCTTATG
AGTTGGACAGCATGCTACGATGACGACTGCTACACGCACCTCAGTGATAAGAACGCAACTGGATGGTTCCCAAAG
GCACCTAAGAAGAAAACACTTGCAATGGTTCTACGACGAACACCATTTAAGCAAGCACAGCTCAAGAAAACTGGA
ATAAGCCAGCAGAGCACCGACGACACAAGCTCAGGAGAAGAGCTGGATACACCAGATGTGTCAGAAACCGAGGAG
GTCTTACCACCTACCTTACGGCGAGAAACGACAGTGATTGGGACTACATCGGAACCAGCACCTCTCACAGATGTC
CAGAAGTCAGCACTTATACGATATCAGCCGGTACCACGCGGAGGCGACCACGCTGTGGCTATAACCGCCATCGAC
ACTGCTACTGCACTTCAGTCTGGATGGACCCCAAGAGGAAGACTCGGAGATGACCCACGGACACTGCCAAGTCAC
GAACATCACGCACAAGTCTCATGGGCATCATGCATCTACCTTACTTGCATGACGCACTTTCGAACCAAGGCGCGA
AACGACGCATTCCCCATTAGGAATGGCTCATTACCGATATCGCGACCATACGGAGACAGAGAACTGCGACACTGG
AGGATCATCAAGGACTATCCTCACGACAAAGTCATGTTGCTCGAACCGGACAGCAACACGCCGATTAAATGTCGA
GACGACACCAACTTGCTATCGACATGCGACTCGATGACATGTCAGATACACGAATTCGGGAAAGTTTGGGAATGG
CATAAATATACGAAGGCAGGACTTCGGAAGCCATCAATCCCGCAAGGACTCCTAATGTCCATTAATTGCGAAGGA
TTCGATAGTCACGAATGCCCACACCCGGAATGCACAGAACATATGCGCGACAAAGCTCGCGACTGGCATAAGCAA
GCAAACGGCACACCAGCGGATTACTGGAAAGAAAGAAGTGACAACCAGAAAAGATTCACCAAAGGAGAACTCACT
CCGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail