Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1486
Gene name
LocationContig_1327:5596..6816
Strand+
Gene length (bp)1220
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00483 NTP_transferase Nucleotidyl transferase 6.8E-06 32 163

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P56287|EI2BE_SCHPO Probable translation initiation factor eIF-2B subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif225 PE=1 SV=1 25 316 2.0E-74
sp|P87163|EI2BE_CANAL Translation initiation factor eIF-2B subunit epsilon OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GCD6 PE=3 SV=2 1 296 4.0E-70
sp|P32501|EI2BE_YEAST Translation initiation factor eIF-2B subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCD6 PE=1 SV=1 13 304 7.0E-58
sp|Q54RF3|EI2BE_DICDI Translation initiation factor eIF-2B subunit epsilon OS=Dictyostelium discoideum GN=eif2b5 PE=3 SV=1 8 316 6.0E-57
sp|Q13144|EI2BE_HUMAN Translation initiation factor eIF-2B subunit epsilon OS=Homo sapiens GN=EIF2B5 PE=1 SV=3 30 301 7.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P56287|EI2BE_SCHPO Probable translation initiation factor eIF-2B subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif225 PE=1 SV=1 25 316 2.0E-74
sp|P87163|EI2BE_CANAL Translation initiation factor eIF-2B subunit epsilon OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GCD6 PE=3 SV=2 1 296 4.0E-70
sp|P32501|EI2BE_YEAST Translation initiation factor eIF-2B subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCD6 PE=1 SV=1 13 304 7.0E-58
sp|Q54RF3|EI2BE_DICDI Translation initiation factor eIF-2B subunit epsilon OS=Dictyostelium discoideum GN=eif2b5 PE=3 SV=1 8 316 6.0E-57
sp|Q13144|EI2BE_HUMAN Translation initiation factor eIF-2B subunit epsilon OS=Homo sapiens GN=EIF2B5 PE=1 SV=3 30 301 7.0E-52
sp|Q64350|EI2BE_RAT Translation initiation factor eIF-2B subunit epsilon OS=Rattus norvegicus GN=Eif2b5 PE=1 SV=2 30 321 1.0E-51
sp|P47823|EI2BE_RABIT Translation initiation factor eIF-2B subunit epsilon OS=Oryctolagus cuniculus GN=EIF2B5 PE=1 SV=1 30 301 2.0E-51
sp|Q8CHW4|EI2BE_MOUSE Translation initiation factor eIF-2B subunit epsilon OS=Mus musculus GN=Eif2b5 PE=1 SV=1 30 321 6.0E-51
sp|P37820|MPG1_SULAC Putative mannose-1-phosphate guanyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=mpg1 PE=3 SV=2 29 161 5.0E-11
sp|Q9M2S0|GMPP2_ARATH Probable mannose-1-phosphate guanylyltransferase 2 OS=Arabidopsis thaliana GN=At3g55590 PE=2 SV=1 30 243 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0016779 nucleotidyltransferase activity Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1486
MSHKGKNSASSSKGKKPAKAAVESKTEDVLQAVVLADSFQDRLRPFTVEKPRCLLPLANTPLIEYTLEFMAMNGV
NEVFIYCGAHAEQVEDHISRSRWSTSSRACPFSVLQFVRVSDARSVGDVLRDLDKRSLVDGDFLLVHGDLVANVM
LDGALAAHRRRREANAANIMTTVLRSGGPRPHRTKAGGVTPVFVVDVPTGRLLQYDEMSPLQEGGHYVALDPAIP
DELSTAFEVRADLIDAEVDICTPEVLALWSESFDYELPRRNFLHGVLKDWELNGKMIYADIVDDGAYAARACNLQ
IPTTDTPTAWSWRRAPATRPTPA*
Coding >Hirsu2|1486
ATGTCGCACAAGGGGAAGAATAGCGCAAGCTCGTCCAAAGGCAAGAAGCCCGCCAAGGCGGCCGTCGAGAGCAAA
ACAGAGGATGTCCTCCAGGCCGTTGTCCTGGCGGACTCGTTCCAGGACAGGTTACGGCCCTTCACGGTCGAGAAG
CCGAGATGCCTCCTCCCGCTCGCGAACACGCCCCTCATCGAGTACACGCTCGAGTTTATGGCCATGAACGGCGTC
AACGAGGTCTTCATCTACTGCGGCGCCCACGCGGAGCAGGTGGAGGACCACATCAGCCGCTCGAGGTGGTCGACG
TCGTCGCGCGCCTGTCCCTTCTCCGTCCTGCAGTTCGTGCGCGTGTCGGACGCGCGCTCCGTCGGCGACGTGCTG
CGCGACCTGGACAAGCGCTCGCTCGTCGACGGCGACTTCCTGCTCGTGCACGGCGACCTCGTCGCCAACGTGATG
CTTGACGGGGCGCTGGCGGCGCACCGCCGCCGGCGCGAGGCCAACGCGGCCAACATCATGACGACGGTCCTGCGC
AGCGGCGGCCCGCGCCCACACCGGACCAAGGCCGGCGGCGTCACGCCCGTCTTCGTCGTCGACGTCCCCACCGGC
CGCCTGCTGCAGTACGACGAGATGAGCCCGCTGCAGGAGGGCGGCCACTACGTCGCGCTCGATCCTGCCATCCCC
GACGAGCTTTCGACGGCGTTCGAGGTGCGGGCCGACCTCATCGACGCCGAGGTCGACATCTGCACACCCGAAGTC
CTCGCCCTCTGGTCCGAGAGCTTCGACTACGAGCTGCCGCGGAGGAATTTCCTGCACGGCGTCCTCAAGGACTGG
GAGCTCAACGGCAAGATGATATACGCCGACATCGTCGACGACGGCGCCTATGCCGCCCGCGCCTGCAACCTTCAG
ATTCCTACCACCGACACGCCAACGGCCTGGTCATGGAGACGAGCGCCGGCCACGCGCCCGACGCCCGCCTGA
Transcript >Hirsu2|1486
ATGTCGCACAAGGGGAAGAATAGCGCAAGCTCGTCCAAAGGCAAGAAGCCCGCCAAGGCGGCCGTCGAGAGCAAA
ACAGAGGATGTCCTCCAGGCCGTTGTCCTGGCGGACTCGTTCCAGGACAGGTTACGGCCCTTCACGGTCGAGAAG
CCGAGATGCCTCCTCCCGCTCGCGAACACGCCCCTCATCGAGTACACGCTCGAGTTTATGGCCATGAACGGCGTC
AACGAGGTCTTCATCTACTGCGGCGCCCACGCGGAGCAGGTGGAGGACCACATCAGCCGCTCGAGGTGGTCGACG
TCGTCGCGCGCCTGTCCCTTCTCCGTCCTGCAGTTCGTGCGCGTGTCGGACGCGCGCTCCGTCGGCGACGTGCTG
CGCGACCTGGACAAGCGCTCGCTCGTCGACGGCGACTTCCTGCTCGTGCACGGCGACCTCGTCGCCAACGTGATG
CTTGACGGGGCGCTGGCGGCGCACCGCCGCCGGCGCGAGGCCAACGCGGCCAACATCATGACGACGGTCCTGCGC
AGCGGCGGCCCGCGCCCACACCGGACCAAGGCCGGCGGCGTCACGCCCGTCTTCGTCGTCGACGTCCCCACCGGC
CGCCTGCTGCAGTACGACGAGATGAGCCCGCTGCAGGAGGGCGGCCACTACGTCGCGCTCGATCCTGCCATCCCC
GACGAGCTTTCGACGGCGTTCGAGGTGCGGGCCGACCTCATCGACGCCGAGGTCGACATCTGCACACCCGAAGTC
CTCGCCCTCTGGTCCGAGAGCTTCGACTACGAGCTGCCGCGGAGGAATTTCCTGCACGGCGTCCTCAAGGACTGG
GAGCTCAACGGCAAGATGATATACGCCGACATCGTCGACGACGGCGCCTATGCCGCCCGCGCCTGCAACCTTCAG
ATTCCTACCACCGACACGCCAACGGCCTGGTCATGGAGACGAGCGCCGGCCACGCGCCCGACGCCCGCCTGA
Gene >Hirsu2|1486
ATGTCGCACAAGGGGAAGAATAGCGCAAGCTCGTCCAAAGGCAAGAAGCCCGCCAAGGCGGCCGTCGAGAGCAAA
ACAGAGGATGTCCTCCAGGCCGTTGTACGTCTCGCTCTCTGTCGTCGCCGCAGCCCGGCCGTCGTGGGCCACCTT
TGCCAACTCACCGCGCCCTCCAGGTCCTGGCGGACTCGTTCCAGGACAGGTTACGGCCCTTCACGGTCGAGAAGC
CGAGAGTGAGTGGCCGAGTCTTCGCCTCTGCTCCTCTTCCCGCGCTCCCGTCCCGGCGCTCCCCCGTGCGCCGCC
GAGCTCACAGCCGATTCGACGACAGTGCCTCCTCCCGCTCGCGAACACGCCCCTCATCGAGTACACGCTCGAGTT
TATGGCCATGAACGGCGTCAACGAGGTCTTCATCTACTGCGGCGCCCACGCGGAGCAGGTGGAGGACCACATCAG
CCGCTCGAGGTGGTCGACGTCGTCGCGCGCCTGTCCCTTCTCCGTCCTGCAGTTCGTGCGCGTGTCGGACGCGCG
CTCCGTCGGCGACGTGCTGCGCGACCTGGACAAGCGCTCGCTCGTCGACGGCGACTTCCTGCTCGTGCACGGCGA
CCTCGTCGCCAACGTGATGCTTGACGGGGCGCTGGCGGCGCACCGCCGCCGGCGCGAGGCCAACGCGGCCAACAT
CATGACGACGGTCCTGCGCAGCGGCGGCCCGCGCCCACACCGGACCAAGGCCGGCGGCGTCACGCCCGTCTTCGT
CGTCGACGTCCCCACCGGCCGCCTGCTGCAGTACGACGAGATGAGCCCGCTGCAGGAGGGCGGCCACTACGTCGC
GCTCGATCCTGCCATCCCCGACGAGCTTTCGACGGCGTTCGAGGTGCGGGCCGACCTCATCGACGCCGAGGTCGA
CATCTGCACACCCGAAGTCCTCGCCCTCTGGTCCGAGAGCTTCGACTACGAGCTGCCGCGGAGGAATTTCCTGCA
CGGCGTCCTCAAGGACTGGGAGCTCAACGGCAAGATGATATACGCCGACATCGTCGACGACGGCGCCTATGCCGC
CCGCGCCTGCAACCTTCAGATGTACGAGGCTATCAGCCGCGACGTCCTCGGCCGCTGGACCTTCCCATTACTGCC
GGAGAATAACGTGGCGCCCGGGCAGTCCTACCACCGACACGCCAACGGCCTGGTCATGGAGACGAGCGCCGGCCA
CGCGCCCGACGCCCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail