Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1482
Gene name
LocationContig_1326:85..2097
Strand+
Gene length (bp)2012
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02535 Zip ZIP Zinc transporter 8.2E-13 118 219
PF02535 Zip ZIP Zinc transporter 3.5E-14 351 458

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12436|ZRT2_YEAST Zinc-regulated transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT2 PE=1 SV=1 221 462 3.0E-20
sp|O94639|ZRT1_SCHPO Zinc-regulated transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zrt1 PE=1 SV=1 221 462 7.0E-19
sp|P32804|ZRT1_YEAST Zinc-regulated transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT1 PE=1 SV=1 115 293 1.0E-11
sp|Q9SLG3|ZIP3_ARATH Zinc transporter 3 OS=Arabidopsis thaliana GN=ZIP3 PE=2 SV=1 98 462 2.0E-11
sp|O81850|IRT2_ARATH Fe(2+) transport protein 2 OS=Arabidopsis thaliana GN=IRT2 PE=1 SV=1 101 287 4.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12436|ZRT2_YEAST Zinc-regulated transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT2 PE=1 SV=1 221 462 3.0E-20
sp|O94639|ZRT1_SCHPO Zinc-regulated transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zrt1 PE=1 SV=1 221 462 7.0E-19
sp|P32804|ZRT1_YEAST Zinc-regulated transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT1 PE=1 SV=1 115 293 1.0E-11
sp|Q9SLG3|ZIP3_ARATH Zinc transporter 3 OS=Arabidopsis thaliana GN=ZIP3 PE=2 SV=1 98 462 2.0E-11
sp|O81850|IRT2_ARATH Fe(2+) transport protein 2 OS=Arabidopsis thaliana GN=IRT2 PE=1 SV=1 101 287 4.0E-11
sp|Q8S3W4|ZIP8_ARATH Probable zinc transporter 8 OS=Arabidopsis thaliana GN=ZIP8 PE=2 SV=1 104 287 3.0E-10
sp|O64738|ZIP6_ARATH Zinc transporter 6, chloroplastic OS=Arabidopsis thaliana GN=ZIP6 PE=3 SV=1 94 294 7.0E-10
sp|Q0DHE3|ZIP9_ORYSJ Zinc transporter 9 OS=Oryza sativa subsp. japonica GN=ZIP9 PE=3 SV=3 354 462 1.0E-08
sp|Q38856|IRT1_ARATH Fe(2+) transport protein 1 OS=Arabidopsis thaliana GN=IRT1 PE=1 SV=2 100 287 1.0E-08
sp|Q8S3W4|ZIP8_ARATH Probable zinc transporter 8 OS=Arabidopsis thaliana GN=ZIP8 PE=2 SV=1 356 462 6.0E-08
sp|Q38856|IRT1_ARATH Fe(2+) transport protein 1 OS=Arabidopsis thaliana GN=IRT1 PE=1 SV=2 356 462 7.0E-08
sp|Q12436|ZRT2_YEAST Zinc-regulated transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT2 PE=1 SV=1 118 215 8.0E-08
sp|A3BI11|ZIP8_ORYSJ Zinc transporter 8 OS=Oryza sativa subsp. japonica GN=ZIP8 PE=2 SV=1 352 462 1.0E-07
sp|O23039|ZIP5_ARATH Zinc transporter 5 OS=Arabidopsis thaliana GN=ZIP5 PE=2 SV=1 360 462 1.0E-07
sp|O82643|ZIP9_ARATH Zinc transporter 9 OS=Arabidopsis thaliana GN=ZIP9 PE=2 SV=1 360 462 2.0E-07
sp|Q8W245|ZIP10_ARATH Probable zinc transporter 10 OS=Arabidopsis thaliana GN=ZIP10 PE=1 SV=2 356 462 2.0E-07
sp|O04089|ZIP4_ARATH Zinc transporter 4, chloroplastic OS=Arabidopsis thaliana GN=ZIP4 PE=2 SV=1 360 462 2.0E-07
sp|Q75HB1|IRT1_ORYSJ Fe(2+) transport protein 1 OS=Oryza sativa subsp. japonica GN=IRT1 PE=2 SV=1 360 462 2.0E-07
sp|Q6L8G0|ZIP5_ORYSJ Zinc transporter 5 OS=Oryza sativa subsp. japonica GN=ZIP5 PE=2 SV=1 352 462 3.0E-07
sp|Q8LE59|IRT3_ARATH Fe(2+) transport protein 3, chloroplastic OS=Arabidopsis thaliana GN=IRT3 PE=2 SV=3 360 418 5.0E-07
sp|O94639|ZRT1_SCHPO Zinc-regulated transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zrt1 PE=1 SV=1 83 219 6.0E-07
sp|Q6L8G1|IRT2_ORYSJ Fe(2+) transport protein 2 OS=Oryza sativa subsp. japonica GN=IRT2 PE=2 SV=1 355 462 2.0E-06
sp|Q5Z653|ZIP10_ORYSJ Zinc transporter 10 OS=Oryza sativa subsp. japonica GN=ZIP10 PE=3 SV=2 360 418 5.0E-06
sp|Q6L8F7|ZIP7_ORYSJ Zinc transporter 7 OS=Oryza sativa subsp. japonica GN=ZIP7 PE=2 SV=1 360 462 7.0E-06
sp|O81850|IRT2_ARATH Fe(2+) transport protein 2 OS=Arabidopsis thaliana GN=IRT2 PE=1 SV=1 356 462 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0030001 metal ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0008150 biological_process No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006811 ion transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0006812 cation transport No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 118 140 22
2 150 172 22
3 193 215 22
4 242 264 22
5 271 293 22
6 360 379 19
7 388 410 22
8 436 458 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1482
LHGTQLFCMAGTADVQMLTTMTQTTDVPVSFTGCHNHGPATYCIGANGDDVELGSAEGEAAPPGGQAHDHDHAAG
DAAGGGHRHCHFHAGVEHCVGGGESESGPAQCDGVKRDYNVPLRVGLLFAIMATSALGVFGPILIQSYLPRKLDL
VFVILKQFGTGIIISTAFVHLYTHASLMFANKCIGELKYESTTSAIVMAGLFLSFVVEYIGQRIVQAKFKSSAAV
TPEERAKAFLSSEVVNILVMEAGILFHSLLIGLTLVVAGDSFFVTLFVVILFHQVFEGLALGTRIATVGTVNHAS
GGAGAASSASASSLTGGGHGDEAVGREDVDKSHGLATAGGPSSALAGRSLGLSMKKKLGLAALFAFVTPIGMAIG
IGVLQKFNGNDKSTLIAIGTLDALSAGILVWVGVVEMWAADWMGGGGGGHGHSHKAELADAGLLTTALALFGLLA
GMVLMSVLGKWA*
Coding >Hirsu2|1482
CTGCACGGGACCCAGCTCTTCTGCATGGCCGGCACGGCTGATGTCCAAATGCTCACCACCATGACCCAGACGACC
GACGTGCCCGTCTCCTTCACCGGCTGCCACAACCACGGGCCTGCCACGTATTGCATCGGCGCCAACGGCGACGAC
GTCGAGCTCGGCTCGGCCGAGGGAGAGGCGGCGCCGCCCGGAGGCCAGGCCCACGACCACGACCACGCGGCCGGA
GACGCGGCCGGCGGCGGCCACCGGCATTGCCACTTCCATGCCGGCGTCGAGCACTGCGTGGGAGGCGGCGAGAGC
GAGTCCGGCCCGGCCCAGTGCGACGGCGTCAAGCGCGACTACAACGTGCCCCTACGCGTCGGGCTTCTCTTCGCC
ATCATGGCCACCAGCGCCCTCGGCGTCTTCGGCCCCATCCTGATCCAGAGCTACTTGCCGCGGAAGCTCGACCTC
GTCTTCGTCATCCTCAAGCAGTTCGGCACCGGCATCATTATCTCCACCGCCTTCGTCCATCTGTACACGCATGCC
TCGCTCATGTTCGCCAACAAGTGCATCGGCGAGCTCAAGTACGAGTCGACGACGTCTGCCATCGTCATGGCCGGC
CTGTTCCTGTCCTTCGTCGTCGAGTACATCGGCCAGCGCATCGTCCAGGCCAAGTTCAAGTCGTCCGCGGCCGTC
ACGCCTGAGGAGCGAGCCAAGGCCTTTCTGTCGAGCGAGGTGGTCAACATCCTGGTCATGGAAGCCGGCATCCTC
TTCCACTCGTTGCTCATCGGCCTCACCCTGGTCGTGGCCGGCGACTCCTTCTTCGTGACGCTGTTCGTCGTCATC
CTCTTCCACCAAGTGTTCGAAGGCCTCGCGCTCGGCACCCGGATCGCCACCGTCGGCACCGTCAACCACGCCTCG
GGCGGGGCGGGGGCGGCGTCGTCGGCGTCGGCGTCGTCGCTGACGGGCGGCGGCCACGGCGACGAGGCCGTCGGG
CGCGAGGACGTGGATAAGTCGCACGGCCTCGCCACGGCGGGCGGCCCGTCGTCGGCGCTGGCGGGCAGGAGCCTC
GGGCTGTCGATGAAGAAGAAGCTCGGACTGGCGGCGCTGTTCGCCTTCGTCACGCCCATCGGCATGGCCATCGGC
ATTGGGGTGCTGCAGAAGTTCAACGGCAACGACAAGTCGACGCTCATCGCCATCGGCACCCTCGACGCCCTCTCG
GCCGGCATCCTCGTCTGGGTCGGCGTCGTCGAGATGTGGGCCGCCGACTGGATGGGCGGCGGCGGCGGCGGCCAC
GGCCACAGCCACAAGGCCGAGCTGGCAGACGCCGGCCTGCTGACGACGGCCCTCGCCCTCTTCGGCCTCCTGGCC
GGCATGGTCCTGATGAGCGTGCTGGGCAAGTGGGCCTAG
Transcript >Hirsu2|1482
CTGCACGGGACCCAGCTCTTCTGCATGGCCGGCACGGCTGATGTCCAAATGCTCACCACCATGACCCAGACGACC
GACGTGCCCGTCTCCTTCACCGGCTGCCACAACCACGGGCCTGCCACGTATTGCATCGGCGCCAACGGCGACGAC
GTCGAGCTCGGCTCGGCCGAGGGAGAGGCGGCGCCGCCCGGAGGCCAGGCCCACGACCACGACCACGCGGCCGGA
GACGCGGCCGGCGGCGGCCACCGGCATTGCCACTTCCATGCCGGCGTCGAGCACTGCGTGGGAGGCGGCGAGAGC
GAGTCCGGCCCGGCCCAGTGCGACGGCGTCAAGCGCGACTACAACGTGCCCCTACGCGTCGGGCTTCTCTTCGCC
ATCATGGCCACCAGCGCCCTCGGCGTCTTCGGCCCCATCCTGATCCAGAGCTACTTGCCGCGGAAGCTCGACCTC
GTCTTCGTCATCCTCAAGCAGTTCGGCACCGGCATCATTATCTCCACCGCCTTCGTCCATCTGTACACGCATGCC
TCGCTCATGTTCGCCAACAAGTGCATCGGCGAGCTCAAGTACGAGTCGACGACGTCTGCCATCGTCATGGCCGGC
CTGTTCCTGTCCTTCGTCGTCGAGTACATCGGCCAGCGCATCGTCCAGGCCAAGTTCAAGTCGTCCGCGGCCGTC
ACGCCTGAGGAGCGAGCCAAGGCCTTTCTGTCGAGCGAGGTGGTCAACATCCTGGTCATGGAAGCCGGCATCCTC
TTCCACTCGTTGCTCATCGGCCTCACCCTGGTCGTGGCCGGCGACTCCTTCTTCGTGACGCTGTTCGTCGTCATC
CTCTTCCACCAAGTGTTCGAAGGCCTCGCGCTCGGCACCCGGATCGCCACCGTCGGCACCGTCAACCACGCCTCG
GGCGGGGCGGGGGCGGCGTCGTCGGCGTCGGCGTCGTCGCTGACGGGCGGCGGCCACGGCGACGAGGCCGTCGGG
CGCGAGGACGTGGATAAGTCGCACGGCCTCGCCACGGCGGGCGGCCCGTCGTCGGCGCTGGCGGGCAGGAGCCTC
GGGCTGTCGATGAAGAAGAAGCTCGGACTGGCGGCGCTGTTCGCCTTCGTCACGCCCATCGGCATGGCCATCGGC
ATTGGGGTGCTGCAGAAGTTCAACGGCAACGACAAGTCGACGCTCATCGCCATCGGCACCCTCGACGCCCTCTCG
GCCGGCATCCTCGTCTGGGTCGGCGTCGTCGAGATGTGGGCCGCCGACTGGATGGGCGGCGGCGGCGGCGGCCAC
GGCCACAGCCACAAGGCCGAGCTGGCAGACGCCGGCCTGCTGACGACGGCCCTCGCCCTCTTCGGCCTCCTGGCC
GGCATGGTCCTGATGAGCGTGCTGGGCAAGTGGGCCTAG
Gene >Hirsu2|1482
CTGCACGGGACCCAGCTGTCCGTCTTCCCCCTCCGCTTCCCCTCGCGCCCGCATCGCGAAAGCCCCCCTTTTGAA
CATTGTTTGTAATTGGTGTTGTTTTGTTCTTTTTGGAACCCGGTGCGCATCCATCGTGCGATTGCGTTGCTAACT
CGTTATCGGTCGGGAAAAACAGCTTCTGCATGGCCGGCACGGCTGATGTCCAAATGCTCACCACCATGACCCAGA
CGACCGACGTGCCCGTCTCCTTCACCGGCTGCCACAACCACGGGCCTGCCACGTGAGTCCCCCATTGCAGATTCC
TTGTCTCTCGGGCGCGATGTCGTGTACTGACTGGGGCGTGTCAGGTATTGCATCGGCGCCAACGGCGACGACGTC
GAGCTCGGCTCGGCCGAGGGAGAGGCGGCGCCGCCCGGAGGCCAGGCCCACGACCACGACCACGCGGCCGGAGAC
GCGGCCGGCGGCGGCCACCGGCATTGCCACTTCCATGCCGGCGTCGAGTGAGTTCTCCCCACGGCGCTCCCGGGC
CCCGGACCTTCGCGCCGGGGCCGGACCGGAGGGCAGAATTCGGCTGACGGCTTTGGCAATGGCGCGTGCAGGCAC
TGCGTGGGAGGCGGCGAGAGCGAGTCCGGCCCGGCCCAGTGCGACGGCGTCAAGCGCGACTACAACGTGCCCCTA
CGCGTCGGGCTTCTCTTCGCCATCATGGCCACCAGCGCCCTCGGTGCGTTTGCCCTCCCTGCCCCCCTTGCGCCT
CTGCGGCCTGCCGTGTCCCGTCCTGTTGGCGGCCTCGGTCTCATGTGTGGCGCGAGGATGGCGGGATGGAAGAGG
CTGACCGTCTTGCCAGGCGTCTTCGGCCCCATCCTGATCCAGAGCTACTTGCCGCGGAAGCTCGACCTCGTCTTC
GTCATCCTCAAGCAGTTCGGCACCGGCATCATTATCTCCACCGCCTTCGTCCATGTACGTACGGCGCGCGTCTCC
CCGCGGTCCGGGATTCGGGGTCAGCGACACAGAGAGACTGACTCGGTGACAGCTGTACACGCATGCCTCGCTCAT
GTTCGCCAACAAGTGCATCGGCGAGCTCAAGTACGAGTCGACGACGTCTGCCATCGTCATGGCCGGCCTGTTCCT
GTCCTTCGTCGTCGAGTACATCGGCCAGCGCATCGTCCAGGCCAAGTTCAAGTCGTCCGCGGCCGTCACGCCTGA
GGAGCGAGCCAAGGCCTTTCTGTCGAGCGAGGTGGTCAACATCCTGGTCATGGAAGCCGGCATCCTCTTCCACTC
GTTGCGTACGTCTCCCTCCCTCCCTCTCTGCACGTCATCACCACACCCTGCCCTCTTCTCCCGCCCCGCGAGCCT
CGAGCTGACCGGGGACTCGTCTGCGCTGGACAATAGTCATCGGCCTCACCCTGGTCGTGGCCGGCGACTCCTTCT
TCGTGACGCTGTTCGTCGTCATCCTCTTCCACCAAGTGTTCGAAGGCCTCGCGCTCGGCACCCGGATCGCCACCG
TCGGCACCGTCAACCACGCCTCGGGCGGGGCGGGGGCGGCGTCGTCGGCGTCGGCGTCGTCGCTGACGGGCGGCG
GCCACGGCGACGAGGCCGTCGGGCGCGAGGACGTGGATAAGTCGCACGGCCTCGCCACGGCGGGCGGCCCGTCGT
CGGCGCTGGCGGGCAGGAGCCTCGGGCTGTCGATGAAGAAGAAGCTCGGACTGGCGGCGCTGTTCGCCTTCGTCA
CGCCCATCGGCATGGCCATCGGCATTGGGGTGCTGCAGAAGTTCAACGGCAACGACAAGTCGACGCTCATCGCCA
TCGGCACCCTCGACGCCCTCTCGGCCGGCATCCTCGTCTGGGTCGGCGTCGTCGAGATGTGGGCCGCCGACTGGA
TGGGCGGCGGCGGCGGCGGCCACGGCCACAGCCACAAGGCCGAGCTGGCAGACGCCGGCCTGCTGACGACGGCCC
TCGCCCTCTTCGGCCTCCTGGCCGGCATGGTCCTGATGAGCGTGCTGGGCAAGTGGGCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail