Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1459
Gene name
LocationContig_132:20287..22258
Strand-
Gene length (bp)1971
Transcript length (bp)1896
Coding sequence length (bp)1896
Protein length (aa) 632

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05187 ETF_QO Electron transfer flavoprotein-ubiquinone oxidoreductase, 4Fe-4S 1.5E-47 525 628
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 8.3E-08 89 144

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87111|ETFD_SCHPO Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20G8.04c PE=3 SV=1 77 631 0.0E+00
sp|Q921G7|ETFD_MOUSE Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Mus musculus GN=Etfdh PE=1 SV=1 68 628 0.0E+00
sp|Q6UPE1|ETFD_RAT Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Rattus norvegicus GN=Etfdh PE=1 SV=1 68 628 0.0E+00
sp|Q16134|ETFD_HUMAN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Homo sapiens GN=ETFDH PE=1 SV=2 68 628 0.0E+00
sp|Q5RDD3|ETFD_PONAB Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Pongo abelii GN=ETFDH PE=2 SV=1 68 628 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87111|ETFD_SCHPO Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20G8.04c PE=3 SV=1 77 631 0.0E+00
sp|Q921G7|ETFD_MOUSE Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Mus musculus GN=Etfdh PE=1 SV=1 68 628 0.0E+00
sp|Q6UPE1|ETFD_RAT Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Rattus norvegicus GN=Etfdh PE=1 SV=1 68 628 0.0E+00
sp|Q16134|ETFD_HUMAN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Homo sapiens GN=ETFDH PE=1 SV=2 68 628 0.0E+00
sp|Q5RDD3|ETFD_PONAB Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Pongo abelii GN=ETFDH PE=2 SV=1 68 628 0.0E+00
sp|Q2KIG0|ETFD_BOVIN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Bos taurus GN=ETFDH PE=2 SV=1 68 628 0.0E+00
sp|P55931|ETFD_PIG Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Sus scrofa GN=ETFDH PE=1 SV=2 68 628 0.0E+00
sp|Q54XM6|ETFD_DICDI Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Dictyostelium discoideum GN=etfdh PE=3 SV=1 80 628 0.0E+00
sp|Q11190|ETFD_CAEEL Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Caenorhabditis elegans GN=let-721 PE=3 SV=2 64 628 0.0E+00
sp|O22854|ETFQO_ARATH Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Arabidopsis thaliana GN=ETFQO PE=2 SV=1 80 630 0.0E+00
sp|Q337B8|ETFQO_ORYSJ Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Oryza sativa subsp. japonica GN=Os10g0516300 PE=3 SV=1 80 628 0.0E+00
sp|Q08822|ETFD_YEAST Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIR2 PE=1 SV=1 43 631 0.0E+00
sp|Q9HZP5|ETFD_PSEAE Electron transfer flavoprotein-ubiquinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA2953 PE=1 SV=1 78 628 1.0E-177
sp|P94132|ETFD_ACIAD Probable electron transfer flavoprotein-ubiquinone oxidoreductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=etfD PE=3 SV=1 77 628 4.0E-174
sp|P26484|FIXC_AZOC5 Protein FixC OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=fixC PE=3 SV=2 83 472 6.0E-26
sp|Q53208|FIXC_RHISN Protein FixC OS=Rhizobium sp. (strain NGR234) GN=fixC PE=3 SV=1 83 473 8.0E-23
sp|P77337|YDIS_ECOLI Probable electron transfer flavoprotein-quinone oxidoreductase YdiS OS=Escherichia coli (strain K12) GN=ydiS PE=3 SV=1 83 474 6.0E-22
sp|P10331|FIXC_BRADU Protein FixC OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixC PE=3 SV=2 115 473 3.0E-21
sp|Q8Z9K9|FIXC_SALTI Protein FixC OS=Salmonella typhi GN=fixC PE=3 SV=1 83 468 2.0E-20
sp|Q8ZRW9|FIXC_SALTY Protein FixC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fixC PE=3 SV=1 83 468 3.0E-20
sp|P68644|FIXC_ECOLI Protein FixC OS=Escherichia coli (strain K12) GN=fixC PE=3 SV=1 83 506 7.0E-19
sp|P68645|FIXC_ECOL6 Protein FixC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fixC PE=3 SV=1 83 506 7.0E-19
sp|Q83SQ7|FIXC_SHIFL Protein FixC OS=Shigella flexneri GN=fixC PE=3 SV=1 83 506 8.0E-19
sp|Q7AHT0|FIXC_ECO57 Protein FixC OS=Escherichia coli O157:H7 GN=fixC PE=3 SV=1 83 506 2.0E-18
sp|P09820|FIXC_RHIME Protein FixC OS=Rhizobium meliloti (strain 1021) GN=fixC PE=3 SV=1 83 473 2.0E-17
sp|P53572|FIXC_AZOVI Protein FixC OS=Azotobacter vinelandii GN=fixC PE=3 SV=1 115 472 4.0E-13
sp|Q46904|YGCN_ECOLI Probable electron transfer flavoprotein-quinone oxidoreductase YgcN OS=Escherichia coli (strain K12) GN=ygcN PE=3 SV=2 115 474 6.0E-13
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1459
MPAPVPASRCVQRSARAALSRWPPSSRPLRPCTLAAAVVARPASRRAAAPVPPSARAFSAGARLRTADADEPFDP
ASVDRESDQVDVCIVGGGPAGLSAAIRLKQLANEAGNDDFRVLVLEKAGDLGAHILSGAVIQPSSINELLPDWLD
EANPNRFEHATPAGADKMRFLTKTSAIPLPAPPQMNNHGNYIVSLNQFVKWLGERAEEVGVEVYPGFAASEVLFD
ADGSVRGVATNDLGITRDGRPKDSFERGMEFHARVTMFGEGCHGSLSKQVINKFDLRKDSQHQTYGLGLKELWEI
DPAKFEKGLIVHSMGYPLARDVYGGSFMYHFGDNLVSLGLVVSLDYQNPWLSPYQEFQKLKHHPLFENVLRGGKC
ISYGARALNEGGFQSIPKVAFPGGALIGDSAGFVNVPKVKGTHNAMKSGMLAAEAAWTALSQSSDGTVFLYDYED
SLRKSPIWAELKAVRNMRPSFHTPLGLYGGLAYSGLEAYLLKGRVPWTLNHKLPDHAATKPADQCSKIAYDKPDG
KISFDILTSVSRTGTNHEEDQPVHLQVQDWDAHADQAYPPFKGLENRFCPAGVYEYVEDESKPHGVRFQINAQNC
IHCKTCDIKSPQQDINWQVPQGGEGPKYYMT*
Coding >Hirsu2|1459
ATGCCGGCTCCCGTCCCGGCGTCGAGGTGCGTCCAGCGCAGCGCGCGAGCCGCCCTCTCGCGATGGCCACCGTCA
AGCCGGCCCCTCCGTCCCTGCACCTTGGCCGCTGCCGTCGTCGCCCGGCCGGCGTCGCGACGAGCGGCCGCGCCG
GTGCCTCCGTCAGCCAGGGCCTTCAGCGCCGGCGCGAGGCTGCGCACGGCCGACGCCGACGAGCCCTTTGACCCT
GCGAGCGTCGACCGCGAATCCGACCAGGTCGACGTCTGCATCGTCGGCGGCGGCCCCGCCGGGCTCAGCGCCGCC
ATCCGCCTCAAGCAGTTGGCCAACGAGGCCGGCAACGACGACTTCCGCGTCCTCGTCCTCGAAAAGGCCGGCGAC
CTGGGCGCGCACATCCTCTCCGGCGCCGTCATCCAGCCCTCCTCCATCAACGAGCTGCTGCCCGACTGGCTCGAC
GAGGCGAACCCGAACCGCTTCGAGCACGCGACGCCCGCCGGCGCCGACAAGATGCGCTTCCTCACCAAAACGTCC
GCCATCCCCCTGCCCGCCCCGCCGCAGATGAACAACCACGGAAACTACATCGTCAGCCTTAACCAGTTCGTCAAG
TGGCTGGGCGAGCGCGCCGAGGAGGTCGGCGTCGAGGTCTACCCCGGCTTCGCCGCCTCCGAGGTGCTCTTCGAC
GCCGACGGGTCCGTCCGGGGCGTCGCCACCAACGACCTGGGCATCACACGCGACGGCAGGCCCAAGGACTCGTTC
GAGCGCGGCATGGAATTCCACGCGAGGGTCACCATGTTCGGCGAGGGCTGCCACGGGAGCCTGAGCAAGCAGGTC
ATCAACAAGTTCGACCTCCGCAAGGACAGCCAACACCAGACCTACGGCCTCGGCCTCAAGGAGCTGTGGGAGATC
GACCCGGCCAAGTTTGAAAAGGGCCTGATCGTCCACTCCATGGGCTACCCGCTGGCTCGGGATGTCTACGGCGGA
TCCTTCATGTACCATTTCGGCGACAACCTCGTCTCCCTGGGGCTGGTCGTGTCGCTCGACTACCAGAACCCGTGG
CTGTCGCCGTACCAGGAGTTCCAGAAGCTGAAGCATCACCCTCTCTTCGAGAACGTCCTGCGCGGCGGCAAGTGC
ATCTCCTACGGCGCTCGCGCCCTGAACGAGGGCGGCTTCCAGTCCATCCCCAAGGTCGCCTTCCCCGGCGGCGCC
CTCATCGGCGACTCGGCCGGCTTCGTCAACGTCCCCAAGGTCAAGGGCACCCACAACGCCATGAAGTCGGGCATG
CTGGCGGCCGAGGCGGCCTGGACGGCCCTCAGCCAGAGCAGCGACGGCACCGTCTTCCTCTACGACTACGAGGAC
TCGCTGCGGAAATCGCCCATCTGGGCCGAGCTCAAGGCGGTACGCAACATGCGGCCCTCCTTCCACACGCCCTTG
GGCCTGTACGGCGGCCTGGCCTATTCCGGGCTGGAAGCCTACTTGCTCAAGGGCCGAGTCCCCTGGACGCTCAAC
CACAAACTTCCCGACCACGCCGCCACCAAGCCGGCGGACCAGTGCTCCAAGATTGCGTACGACAAGCCCGACGGC
AAGATCAGCTTCGACATCCTCACCAGTGTCTCTCGGACCGGCACCAACCACGAGGAGGACCAGCCTGTCCATCTG
CAAGTCCAGGACTGGGACGCCCACGCCGACCAGGCCTACCCCCCGTTCAAGGGCTTGGAGAATCGCTTCTGTCCG
GCCGGCGTGTACGAGTATGTCGAGGACGAGTCCAAGCCGCACGGCGTGAGGTTCCAGATCAACGCCCAAAACTGC
ATTCATTGCAAGACGTGCGATATCAAATCGCCGCAGCAAGACATCAATTGGCAAGTGCCGCAGGGAGGCGAGGGG
CCCAAGTACTACATGACGTGA
Transcript >Hirsu2|1459
ATGCCGGCTCCCGTCCCGGCGTCGAGGTGCGTCCAGCGCAGCGCGCGAGCCGCCCTCTCGCGATGGCCACCGTCA
AGCCGGCCCCTCCGTCCCTGCACCTTGGCCGCTGCCGTCGTCGCCCGGCCGGCGTCGCGACGAGCGGCCGCGCCG
GTGCCTCCGTCAGCCAGGGCCTTCAGCGCCGGCGCGAGGCTGCGCACGGCCGACGCCGACGAGCCCTTTGACCCT
GCGAGCGTCGACCGCGAATCCGACCAGGTCGACGTCTGCATCGTCGGCGGCGGCCCCGCCGGGCTCAGCGCCGCC
ATCCGCCTCAAGCAGTTGGCCAACGAGGCCGGCAACGACGACTTCCGCGTCCTCGTCCTCGAAAAGGCCGGCGAC
CTGGGCGCGCACATCCTCTCCGGCGCCGTCATCCAGCCCTCCTCCATCAACGAGCTGCTGCCCGACTGGCTCGAC
GAGGCGAACCCGAACCGCTTCGAGCACGCGACGCCCGCCGGCGCCGACAAGATGCGCTTCCTCACCAAAACGTCC
GCCATCCCCCTGCCCGCCCCGCCGCAGATGAACAACCACGGAAACTACATCGTCAGCCTTAACCAGTTCGTCAAG
TGGCTGGGCGAGCGCGCCGAGGAGGTCGGCGTCGAGGTCTACCCCGGCTTCGCCGCCTCCGAGGTGCTCTTCGAC
GCCGACGGGTCCGTCCGGGGCGTCGCCACCAACGACCTGGGCATCACACGCGACGGCAGGCCCAAGGACTCGTTC
GAGCGCGGCATGGAATTCCACGCGAGGGTCACCATGTTCGGCGAGGGCTGCCACGGGAGCCTGAGCAAGCAGGTC
ATCAACAAGTTCGACCTCCGCAAGGACAGCCAACACCAGACCTACGGCCTCGGCCTCAAGGAGCTGTGGGAGATC
GACCCGGCCAAGTTTGAAAAGGGCCTGATCGTCCACTCCATGGGCTACCCGCTGGCTCGGGATGTCTACGGCGGA
TCCTTCATGTACCATTTCGGCGACAACCTCGTCTCCCTGGGGCTGGTCGTGTCGCTCGACTACCAGAACCCGTGG
CTGTCGCCGTACCAGGAGTTCCAGAAGCTGAAGCATCACCCTCTCTTCGAGAACGTCCTGCGCGGCGGCAAGTGC
ATCTCCTACGGCGCTCGCGCCCTGAACGAGGGCGGCTTCCAGTCCATCCCCAAGGTCGCCTTCCCCGGCGGCGCC
CTCATCGGCGACTCGGCCGGCTTCGTCAACGTCCCCAAGGTCAAGGGCACCCACAACGCCATGAAGTCGGGCATG
CTGGCGGCCGAGGCGGCCTGGACGGCCCTCAGCCAGAGCAGCGACGGCACCGTCTTCCTCTACGACTACGAGGAC
TCGCTGCGGAAATCGCCCATCTGGGCCGAGCTCAAGGCGGTACGCAACATGCGGCCCTCCTTCCACACGCCCTTG
GGCCTGTACGGCGGCCTGGCCTATTCCGGGCTGGAAGCCTACTTGCTCAAGGGCCGAGTCCCCTGGACGCTCAAC
CACAAACTTCCCGACCACGCCGCCACCAAGCCGGCGGACCAGTGCTCCAAGATTGCGTACGACAAGCCCGACGGC
AAGATCAGCTTCGACATCCTCACCAGTGTCTCTCGGACCGGCACCAACCACGAGGAGGACCAGCCTGTCCATCTG
CAAGTCCAGGACTGGGACGCCCACGCCGACCAGGCCTACCCCCCGTTCAAGGGCTTGGAGAATCGCTTCTGTCCG
GCCGGCGTGTACGAGTATGTCGAGGACGAGTCCAAGCCGCACGGCGTGAGGTTCCAGATCAACGCCCAAAACTGC
ATTCATTGCAAGACGTGCGATATCAAATCGCCGCAGCAAGACATCAATTGGCAAGTGCCGCAGGGAGGCGAGGGG
CCCAAGTACTACATGACGTGA
Gene >Hirsu2|1459
ATGCCGGCTCCCGTCCCGGCGTCGAGGTGCGTCCAGCGCAGCGCGCGAGCCGCCCTCTCGCGATGGCCACCGTCA
AGCCGGCCCCTCCGTCCCTGCACCTTGGCCGCTGCCGTCGTCGCCCGGCCGGCGTCGCGACGAGCGGCCGCGCCG
GTGCCTCCGTCAGCCAGGGCCTTCAGCGCCGGCGCGAGGCTGCGCACGGCCGACGCCGACGAGCCCTTTGACCCT
GCGAGCGTCGACCGCGAATCCGACCAGGTCGACGTCTGCATCGTCGGCGGCGGCCCCGCCGGGCTCAGCGCCGCC
ATCCGCCTCAAGCAGTTGGCCAACGAGGCCGGCAACGACGACTTCCGCGTCCTCGTCCTCGAAAAGGCCGGCGAC
CTGGGCGCGCACATCCTCTCCGGCGCCGTCATCCAGCCCTCCTCCATCAACGAGCTGCTGCCCGACTGGCTCGAC
GAGGCGAACCCGAACCGCTTCGAGCACGCGACGCCCGCCGGCGCCGACAAGATGCGCTTCCTCACCAAAACGTCC
GCCATCCCCCTGCCCGCCCCGCCGCAGATGAACAACCACGGAAACTACATCGTCAGCCTTAACCAGTTCGTCAAG
TGGCTGGGCGAGCGCGCCGAGGAGGTCGGCGTCGAGGTCTACCCCGGCTTCGCCGCCTCCGAGGTGCTCTTCGAC
GCCGACGGGTCCGTCCGGGGCGTCGCCACCAACGACCTGGGCATCACACGCGACGGCAGGCCCAAGGACTCGTTC
GAGCGCGGCATGGAATTCCACGCGAGGGTCACCATGTTCGGCGAGGGCTGCCACGGGAGCCTGAGCAAGCAGGTC
ATCAACAAGTTCGACCTCCGCAAGGACAGCCAACACCAGACCTACGGCCTCGGCCTCAAGGAGCTGTGGGAGATC
GACCCGGCCAAGTTTGAAAAGGGCCTGATCGTCCACTCCATGGGCTACCCGCTGGCTCGGGATGTCTACGGCGGA
TCCTTCATGTACCATTTCGGCGACAACCTCGTCTCCCTGGGGCTGGTCGTGTCGCTCGACTACCAGAACCCGTGG
CTGTCGCCGTACCAGGAGTTCCAGAAGCTGAAGCATCACCCTCTCTTCGAGAACGTCCTGCGCGGCGGCAAGTGC
ATCTCCTACGGCGCTCGCGCCCTGAACGAGGGCGGCTTCCAGTCCATCCCCAAGGTCGCCTTCCCCGGCGGCGCC
CTCATCGGCGACTCGGCCGGCTTCGTCAACGTCCCCAAGGTCAAGGGCACCCACAACGCCATGAAGTCGGGCATG
CTGGCGGCCGAGGCGGCCTGGACGGCCCTCAGCCAGAGCAGCGACGGCACCGTCTTCCTCTACGACTACGAGGAC
TCGCTGCGGAAATCGCCCATCTGGGCCGAGCTCAAGGCGGTACGCAACATGCGGCCCTCCTTCCACACGCCCTTG
GGCCTGTACGGCGGCCTGGCCTATTCCGGGCTGGAAGCCTACTTGCTCAAGGGCCGAGTCCCCTGGACGCTCAAC
CACAAACTTCCCGACCACGCCGCCACCAAGCCGGCGGACCAGTGCTCCAAGATTGCGTACGACAAGCCCGACGGC
AAGATCAGCTTCGACATCCTCACCAGTGTCTCTCGGACCGGCACCAACCACGAGGAGGACCAGCCTGTCCATCTG
CAAGTCCAGGACTGGGACGCCCACGCCGACCAGGCCTACCCCCCGTTCAAGGGCTTGGAGAATCGCTTCTGTCCG
GCCGGCGTGTACGAGTATGTCGAGGACGAGTCCAAGCCGCACGGCGTGAGGTTCCAGATCAACGCCCAAAAGTGA
GACCCCGGCGAGCCCCTGTCGTGCCCAAGTAACCCCAAGAAAGGCCGCGCTGACCACGATGCTCCCGTTAGCTGC
ATTCATTGCAAGACGTGCGATATCAAATCGCCGCAGCAAGACATCAATTGGCAAGTGCCGCAGGGAGGCGAGGGG
CCCAAGTACTACATGACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail