Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1451
Gene name
LocationContig_132:1845..2763
Strand-
Gene length (bp)918
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10294 Methyltransf_16 Lysine methyltransferase 8.6E-08 49 136

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I2X5|NNT1_GIBZE Protein N-methyltransferase NNT1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NNT1 PE=3 SV=2 4 299 1.0E-111
sp|Q7S634|NNT1_NEUCR Protein N-methyltransferase nnt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nnt-1 PE=3 SV=1 4 300 8.0E-80
sp|Q4WYS7|NNT1_ASPFU Protein N-methyltransferase nnt1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nnt1 PE=3 SV=1 2 299 3.0E-50
sp|Q9UT28|NNT1_SCHPO Protein N-methyltransferase nnt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nnt1 PE=3 SV=1 2 300 7.0E-50
sp|Q5BAD0|NNT1_EMENI Protein N-methyltransferase nnt1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nnt1 PE=3 SV=1 1 299 4.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I2X5|NNT1_GIBZE Protein N-methyltransferase NNT1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NNT1 PE=3 SV=2 4 299 1.0E-111
sp|Q7S634|NNT1_NEUCR Protein N-methyltransferase nnt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nnt-1 PE=3 SV=1 4 300 8.0E-80
sp|Q4WYS7|NNT1_ASPFU Protein N-methyltransferase nnt1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nnt1 PE=3 SV=1 2 299 3.0E-50
sp|Q9UT28|NNT1_SCHPO Protein N-methyltransferase nnt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nnt1 PE=3 SV=1 2 300 7.0E-50
sp|Q5BAD0|NNT1_EMENI Protein N-methyltransferase nnt1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nnt1 PE=3 SV=1 1 299 4.0E-44
sp|Q05874|NNT1_YEAST Protein N-methyltransferase NNT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NNT1 PE=1 SV=1 10 297 1.0E-42
sp|Q6CUI0|NNT1_KLULA Protein N-methyltransferase NNT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NNT1 PE=3 SV=1 8 297 8.0E-41
sp|Q6BKI8|NNT1_DEBHA Protein N-methyltransferase NNT1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NNT1 PE=3 SV=1 2 297 3.0E-40
sp|Q5A013|NNT1_CANAL Protein N-methyltransferase NNT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NNT1 PE=3 SV=1 8 297 1.0E-38
sp|Q6CHE9|NNT1_YARLI Protein N-methyltransferase NNT1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NNT1 PE=3 SV=1 3 297 8.0E-30
sp|Q74ZB5|NNT1_ASHGO Protein N-methyltransferase NNT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NNT1 PE=3 SV=1 2 144 3.0E-28
sp|Q6FJ22|NNT1_CANGA Protein N-methyltransferase NNT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NNT1 PE=3 SV=1 10 145 6.0E-26
sp|P0CP44|NNT1_CRYNJ Protein N-methyltransferase NNT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NNT1 PE=3 SV=1 35 144 5.0E-20
sp|P0CP45|NNT1_CRYNB Protein N-methyltransferase NNT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NNT1 PE=3 SV=1 35 144 5.0E-20
sp|Q74ZB5|NNT1_ASHGO Protein N-methyltransferase NNT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NNT1 PE=3 SV=1 200 297 6.0E-11
sp|P0CP44|NNT1_CRYNJ Protein N-methyltransferase NNT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NNT1 PE=3 SV=1 202 295 2.0E-10
sp|P0CP45|NNT1_CRYNB Protein N-methyltransferase NNT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NNT1 PE=3 SV=1 202 295 2.0E-10
sp|Q8BLU2|MT21C_MOUSE Protein-lysine methyltransferase METTL21C OS=Mus musculus GN=Mettl21c PE=2 SV=1 11 135 4.0E-08
sp|Q5VZV1|MT21C_HUMAN Protein-lysine methyltransferase METTL21C OS=Homo sapiens GN=METTL21C PE=1 SV=1 6 135 1.0E-07
sp|A6QP81|MT21C_BOVIN Protein-lysine methyltransferase METTL21C OS=Bos taurus GN=METTL21C PE=2 SV=1 11 133 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1451
MDDDYGTGTLLEEPEDYYPATPPPTQQEHRMRSGRALTLHLVGRSPTEAHVLWNGARFVADYLEAEPGRVRGRTV
LELGAAAGLPSLVAALLGARKVVMTDFPDPDLVANMQKNIDGCGAPAGVVDAAGFVWGGDAAPLLARLPGPDDDD
NNDDSNPDSAQHAQQQQQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQRRFDVLILADLLFRHSEHGALVKTI
GETLGRGPGAAAYVFFTSYRPWKQRLDMAFFDVARAAGLEVEPVAERRLDRPLFDGDPGDLDVQKTVRGFVLRWP
GGGPD*
Coding >Hirsu2|1451
ATGGACGACGACTACGGAACGGGGACGCTGCTGGAGGAGCCGGAGGACTACTACCCGGCGACGCCGCCGCCGACG
CAGCAGGAGCACCGGATGCGCAGCGGGCGGGCGCTGACGCTGCACCTCGTGGGCCGGAGCCCGACGGAGGCGCAC
GTGCTGTGGAACGGGGCCCGGTTCGTGGCCGACTACCTCGAGGCCGAGCCCGGGCGGGTGCGGGGCCGGACGGTG
CTGGAGCTGGGCGCGGCGGCCGGGCTGCCGTCGCTGGTGGCGGCGCTGCTGGGCGCGCGCAAGGTCGTCATGACC
GACTTCCCGGACCCGGACCTGGTGGCCAACATGCAAAAGAACATTGACGGCTGCGGCGCCCCGGCCGGCGTCGTC
GACGCGGCCGGCTTCGTCTGGGGCGGCGACGCGGCGCCGCTGCTGGCGCGGCTGCCGGGACCCGACGACGACGAC
AACAACGACGACTCCAACCCCGACTCTGCGCAGCATGCGCAGCAGCAACAGCAACAACAGCACCAGCAACAGCAA
CAGCAACAACAGCAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAGCAG
CGGCGGTTCGACGTGCTGATCCTGGCGGACCTGCTCTTCCGCCACTCGGAGCACGGGGCGCTGGTCAAGACGATC
GGCGAGACGCTGGGCCGCGGGCCCGGCGCCGCCGCCTACGTCTTCTTCACCTCGTACCGGCCGTGGAAGCAGCGG
CTCGACATGGCCTTCTTCGACGTCGCGCGCGCCGCCGGCCTCGAGGTCGAGCCCGTGGCCGAGCGGCGCCTGGAC
CGGCCGCTCTTCGACGGCGACCCGGGCGACCTCGACGTCCAGAAGACGGTCAGGGGGTTTGTCCTGCGCTGGCCG
GGCGGGGGGCCCGACTGA
Transcript >Hirsu2|1451
ATGGACGACGACTACGGAACGGGGACGCTGCTGGAGGAGCCGGAGGACTACTACCCGGCGACGCCGCCGCCGACG
CAGCAGGAGCACCGGATGCGCAGCGGGCGGGCGCTGACGCTGCACCTCGTGGGCCGGAGCCCGACGGAGGCGCAC
GTGCTGTGGAACGGGGCCCGGTTCGTGGCCGACTACCTCGAGGCCGAGCCCGGGCGGGTGCGGGGCCGGACGGTG
CTGGAGCTGGGCGCGGCGGCCGGGCTGCCGTCGCTGGTGGCGGCGCTGCTGGGCGCGCGCAAGGTCGTCATGACC
GACTTCCCGGACCCGGACCTGGTGGCCAACATGCAAAAGAACATTGACGGCTGCGGCGCCCCGGCCGGCGTCGTC
GACGCGGCCGGCTTCGTCTGGGGCGGCGACGCGGCGCCGCTGCTGGCGCGGCTGCCGGGACCCGACGACGACGAC
AACAACGACGACTCCAACCCCGACTCTGCGCAGCATGCGCAGCAGCAACAGCAACAACAGCACCAGCAACAGCAA
CAGCAACAACAGCAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAGCAG
CGGCGGTTCGACGTGCTGATCCTGGCGGACCTGCTCTTCCGCCACTCGGAGCACGGGGCGCTGGTCAAGACGATC
GGCGAGACGCTGGGCCGCGGGCCCGGCGCCGCCGCCTACGTCTTCTTCACCTCGTACCGGCCGTGGAAGCAGCGG
CTCGACATGGCCTTCTTCGACGTCGCGCGCGCCGCCGGCCTCGAGGTCGAGCCCGTGGCCGAGCGGCGCCTGGAC
CGGCCGCTCTTCGACGGCGACCCGGGCGACCTCGACGTCCAGAAGACGGTCAGGGGGTTTGTCCTGCGCTGGCCG
GGCGGGGGGCCCGACTGA
Gene >Hirsu2|1451
ATGGACGACGACTACGGAACGGGGACGCTGCTGGAGGAGCCGGAGGACTACTACCCGGCGACGCCGCCGCCGACG
CAGCAGGAGCACCGGATGCGCAGCGGGCGGGCGCTGACGCTGCACCTCGTGGGCCGGAGCCCGACGGAGGCGCAC
GTGCTGTGGAACGGGGCCCGGTTCGTGGCCGACTACCTCGAGGCCGAGCCCGGGCGGGTGCGGGGCCGGACGGTG
CTGGAGCTGGGCGCGGCGGCCGGGCTGCCGTCGCTGGTGGCGGCGCTGCTGGGCGCGCGCAAGGTCGTCATGACC
GACTTCCCGGACCCGGACCTGGTGGCCAACATGCAAAAGAACATTGACGGCTGCGGCGCCCCGGCCGGCGTCGTC
GACGCGGCCGGCTTCGTCTGGGGCGGCGACGCGGCGCCGCTGCTGGCGCGGCTGCCGGGACCCGACGACGACGAC
AACAACGACGACTCCAACCCCGACTCTGCGCAGCATGCGCAGCAGCAACAGCAACAACAGCACCAGCAACAGCAA
CAGCAACAACAGCAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAACAGCAGCAG
CGGCGGTTCGACGTGCTGATCCTGGCGGACCTGCTCTTCCGCCACTCGGAGCACGGGGCGCTGGTCAAGACGATC
GGCGAGACGCTGGGCCGCGGGCCCGGCGCCGCCGCCTACGTCTTCTTCACCTCGTACCGGCCGTGGAAGCAGCGG
CTCGACATGGCCTTCTTCGACGTCGCGCGCGCCGCCGGCCTCGAGGTCGAGCCCGTGGCCGAGCGGCGCCTGGAC
CGGCCGCTCTTCGACGGCGACCCGGGCGACCTCGACGTCCAGAAGACGGTCAGGGGGTTTGTCCTGCGCTGGCCG
GGCGGGGGGCCCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail